SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000081045 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000081045
Domain Number 1 Region: 211-404
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.79e-64
Family Reprolysin-like 0.00014
Further Details:      
 
Domain Number 2 Region: 423-499
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 1.83e-20
Family Blood coagulation inhibitor (disintegrin) 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000081045   Gene: ENSMUSG00000031555   Transcript: ENSMUST00000084032
Sequence length 841
Comment pep:known chromosome:GRCm38:8:24949653:25016812:-1 gene:ENSMUSG00000031555 transcript:ENSMUST00000084032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPRALSPLASLRLRWLLACGLLGPVLEAGRPDLEQTVHLSSYEIITPWRLTRERREALG
PSSQQISYVIQAQGKQHIIHLERNTDLLPNDFVVYTYDKEGSLLSDHPNVQSHCHYRGYV
EGVQNSAVAVSACFGLRGLLHLENASFGIEPLHNSSHFEHIFYPMDGIHQEPLRCGVSNR
DTEKEGTQGDEEEHPSVTQLLRRRRAVLPQTRYVELFIVVDKERYDMMGRNQTAVREEMI
RLANYLDSMYIMLNIRIVLVGLEIWTDRNPINIIGGAGDVLGNFVQWREKFLITRWRHDS
AQLVLKKGFGGTAGMAFVGTVCSRSHAGGINVFGQITVETFASIVAHELGHNLGMNHDDG
RECFCGAKSCIMNSGASGSRNFSSCSAEDFEKLTLNKGGSCLLNIPKPDEAYSAPSCGNK
LVDPGEECDCGTAKECEVDPCCEGSTCKLKSFAECAYGDCCKDCQFLPGGSMCRGKTSEC
DVPEYCNGSSQFCPPDVFIQNGYPCQNSKAYCYNGMCQYYDAQCQVIFGSKAKAAPRDCF
IEVNSKGDRFGNCGFSGSEYKKCATGNALCGKLQCENVQDMPVFGIVPAIIQTPSRGTKC
WGVDFQLGSDVPDPGMVNEGTKCDAGKICRNFQCVNASVLNYDCDIQGKCHGHGVCNSNK
NCHCEDGWAPPHCDTKGYGGSVDSGPTYNAKSTALRDGLLVFFFLIVPLVAAAIFLFIKR
DELRKTFRKKRSQMSDGRNQANVSRQPGDPSISRPPGGPNVSRPPGGPGVSRPPGGPGVS
RPPGGPRCLQTATWAWKQIPSTNLRRQAACAVPVKATSTTTENIFSGKLDSGSARSCTSF
I
Download sequence
Identical sequences E9Q638
ENSMUSP00000081045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]