SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000081312 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000081312
Domain Number 1 Region: 506-821
Classification Level Classification E-value
Superfamily Ribonuclease H-like 6.57e-84
Family PIWI domain 0.055
Further Details:      
 
Domain Number 2 Region: 29-375
Classification Level Classification E-value
Superfamily PAZ domain 2.98e-68
Family PAZ domain 0.000000245
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000081312   Gene: ENSMUSG00000042500   Transcript: ENSMUST00000084289
Sequence length 861
Comment pep:known chromosome:GRCm38:4:126489541:126533472:-1 gene:ENSMUSG00000042500 transcript:ENSMUST00000084289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEALGPGPPASLFQPPRRPGLGTVGKPIRLLANHFQVQIPKIDVYHYDVDIKPEKRPRRV
NREVVDTMVRHFKMQIFGDRQPGYDGKRNMYTAHPLPIGRDRIDMEVTLPGEGKDQTFKV
SVQWVSVVSLQLLLEALAGHLNEVPDDSVQALDVITRHLPSMRYTPVGRSFFSPPEGYYH
PLGGGREVWFGFHQSVRPAMWNMMLNIDVSATAFYRAQPIIEFMCEVLDIQNINEQTKPL
TDSQRVKFTKEIRGLKVEVTHCGQMKRKYRVCNVTRRPASHQTFPLQLENGQAMECTVAQ
YFKQKYSLQLKHPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIKATAR
SAPDRQEEISRLVKSNSMVGGPDPYLKEFGIVVHNEMTELTGRVLPAPMLQYGGRNKTVA
TPSQGVWDMRGKQFYAGIEIKVWAVACFAPQKQCREDLLKSFTDQLRKISKDAGMPIQGQ
PCFCKYAQGADSVEPMFKHLKMTYVGLQLIVVILPGKTPVYAEVKRVGDTLLGMATQCVQ
VKNVVKTSPQTLSNLCLKMNAKLGGINNVLVPHQRPSVFQQPVIFLGADVTHPPAGDGKK
PSIAAVVGSMDGHPSRYCATVRVQTSRQEITQELLYSQEVVQDLTSMARELLIQFYKSTR
FKPTRIIYYRGGVSEGQMKQVAWPELIAIRKACISLEEDYRPGITYIVVQKRHHTRLFCA
DKMERVGKSGNVPAGTTVDSTVTHPSEFDFYLCSHAGIQGTSRPSHYQVLWDDNCFTADE
LQLLTYQLCHTYVRCTRSVSIPAPAYYARLVAFRARYHLVDKDHDSAEGSHVSGQSNGRD
PQALAKAVQIHHDTQHTMYFA
Download sequence
Identical sequences Q8CJF8
NP_694817.2.92730 ENSMUSP00000081312 ENSMUSP00000081312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]