SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000081840 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000081840
Domain Number 1 Region: 120-318
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.83e-70
Family Arfaptin, Rac-binding fragment 0.0000000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000081840   Gene: ENSMUSG00000030881   Transcript: ENSMUST00000084782
Sequence length 341
Comment pep:known chromosome:GRCm38:7:105635657:105640351:-1 gene:ENSMUSG00000030881 transcript:ENSMUST00000084782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDGILGKAATMEIPIHGNGEAGQLPEDDGLEQDLQQVMVSGPNLNETSIVSGGYGGSGD
GLIPTGSGRHPSHSTSPSGPGDEVARGIAGEKFDIVKKWGINTYKCTKQLLSERFGRGSR
TVDLELELQIELLRETKRKYESVLQLGRALTAHLYSLLQTQHALGDAFADLSQKSPELQE
EFGYNAETQKLLCKNGETLLGAVNFFVSSINTLVTKTMEDTLMTVKQYEAARLEYDAYRT
DLEELSLGPRDAGTRGRLESAQATFQTHRDKYEKLRGDVAIKLKFLEENKIKVMHKQLLL
FHNAVSAYFAGNQKQLEQTLQQFNIKLRPPGAEKPSWLEEQ
Download sequence
Identical sequences A0A1A6HRE6 A0A1U8CQD2 G3IDF4 Q6AY65 Q8K221
NP_001004222.1.100692 NP_001004222.1.4139 NP_084078.3.92730 XP_003512908.1.69978 XP_005087490.1.91757 XP_005370280.1.66349 XP_006229995.1.100692 XP_006991796.1.50099 XP_007612352.1.28591 XP_007612353.1.28591 XP_007651455.1.69978 XP_012981716.1.91757 XP_013210293.1.66349 XP_015865482.1.50099 XP_021510760.1.76796 XP_021510761.1.76796 ENSMUSP00000081840 ENSMUSP00000120387 10090.ENSMUSP00000120387 10116.ENSRNOP00000025159 ENSMUSP00000033171 ENSRNOP00000025159 ENSRNOP00000025159 ENSMUSP00000081840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]