SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000081956 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000081956
Domain Number 1 Region: 576-927
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.34e-110
Family PDEase 0.00000219
Further Details:      
 
Domain Number 2 Region: 403-571
Classification Level Classification E-value
Superfamily GAF domain-like 2.16e-47
Family GAF domain 0.0000000626
Further Details:      
 
Domain Number 3 Region: 219-402
Classification Level Classification E-value
Superfamily GAF domain-like 5.23e-36
Family GAF domain 0.00000000666
Further Details:      
 
Domain Number 4 Region: 43-201
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000000112
Family GAF domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000081956   Gene: ENSMUSG00000030653   Transcript: ENSMUST00000084894
Sequence length 935
Comment pep:known chromosome:GRCm38:7:101421691:101512829:1 gene:ENSMUSG00000030653 transcript:ENSMUST00000084894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQACGHSILCRSQQYPAARPAEPRGQQVFLKPDEPPPQPCADSLQDALLSLGAVIDIAG
LRQAARDALSAVLPKVETVYTYLLDGESRLVCEDPPHELPQEGKIREAVISQKRLSCNGL
GPSDLLGKPLARLVAPLAPDMQVLVIPLLDKETGSVAAVILVHCGQLSDSEEQSLQVVEK
HALVALRRVQALQQRRPEAVQNTSVDASEDQKDEKGYTDHDRKILQLCGELFDLDATSLQ
LKVLQYLQQETQATHCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPLTMGRLGQVVEDKQC
IQLKDLTSDDVQQLQNMLGCELQAMLCVPVISRATDQVVALACAFNKLGGDFFTDEDEHV
IQHCFHYTGTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLS
NAEICSVFLLDQNELVAKVFDGGVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHP
LFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCG
ISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFANFTY
TPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVS
HFCYLLYKNLELSNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSV
MERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAE
VGYDRNNRQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPM
EMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIR
GLPSNNSLDFLDEEYEVPDLDGTRAPVNGCCSLEG
Download sequence
Identical sequences Q5PR72
ENSMUSP00000081956 ENSMUSP00000127521 NP_001008548.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]