SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000082533 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000082533
Domain Number 1 Region: 324-545
Classification Level Classification E-value
Superfamily vWA-like 4.11e-51
Family Integrin A (or I) domain 0.00025
Further Details:      
 
Domain Number 2 Region: 164-353
Classification Level Classification E-value
Superfamily vWA-like 2.05e-43
Family Integrin A (or I) domain 0.0012
Further Details:      
 
Domain Number 3 Region: 32-126
Classification Level Classification E-value
Superfamily LCCL domain 2.48e-26
Family LCCL domain 0.00000278
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000082533   Gene: ENSMUSG00000020953   Transcript: ENSMUST00000085412
Sequence length 552
Comment pep:known chromosome:GRCm38:12:51593341:51605773:1 gene:ENSMUSG00000020953 transcript:ENSMUST00000085412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSSRIPALCLGAWLLLLLLPRFARAEGAVPIPVTCFTRGLDIRKEKADVLCPGGCSLEE
FSVFGNIVYASVSSICGAAVHRGVIGTSGGPVRVYSLPGRENYSSVDANGIQSQMLSRWS
ASFAVTKGKSSTQEATGRAVSTAHPPSGKRLKKTPEKKTGNKDCKADIAFLIDGSFNIGQ
RRFNLQKNFVGKVALMLGIGTEGPHVGLVQASEHPKIEFYLKNFTSAKDVLFAIKEVGFR
GGNSNTGKALKHTAQKFFTADTGVRKGIPKVVVVFIDGWPSDDIEEAGIVAREFGVNVFI
VSVAKPIPEELGMVQDVAFVDKAVCRNNGFFSYHMPNWFGTTKYVKPLVQKLCTHEQMMC
SKTCYNSVNIAFLIDGSSSVGDSNFRLMLEFVSNIAKTFEISDIGAKIAAVQFTYDQRTE
FSFTDYNTKENVLAVLANIRYMSGGTATGDAIAFTVRNVFGPIRDSPNKNFLVIVTDGQS
YDDVRGPAAAAHDAGITIFSVGVAWAPLDDLRDMASKPKESHAFFTREFTGLEPIVSDVI
RGICRDFLESQQ
Download sequence
Identical sequences Q62507
ENSMUSP00000082533 ENSMUSP00000082533 ENSMUSP00000082533 ENSMUSP00000128127 NP_001185764.1.92730 NP_031754.1.92730 10090.ENSMUSP00000082533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]