SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000082856 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000082856
Domain Number 1 Region: 16-190
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 5.1e-60
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.0000000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000082856   Gene: ENSMUSG00000063849   Transcript: ENSMUST00000085709
Sequence length 204
Comment pep:known chromosome:GRCm38:9:57412668:57440114:-1 gene:ENSMUSG00000063849 transcript:ENSMUST00000085709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPKAPCPAAVPSEERKFRVLVGVTGSVAALKLPLLVSKLLDVPGLEVTVVTTERAKHFY
SPQDVPVTLYSDADEWEMWKRRSDPVLHIDLRRWADLMLVAPLDANTLGKVASGICDNLL
TCVIRAWDLNKPLLFCPAMNTAMWEHPLTAQQVAQLKAFGYVEIPCVSKKLVCGDQGLGA
MAEVETIVAKVQAVLSQHGSIQQS
Download sequence
Identical sequences Q8BZB2
ENSMUSP00000082856 NP_789801.1.92730 XP_006511423.1.92730 XP_006511424.1.92730 XP_006511425.1.92730 XP_006511426.1.92730 XP_011241091.1.92730 XP_017169007.1.92730 10090.ENSMUSP00000082856 ENSMUSP00000082856 ENSMUSP00000082856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]