SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000085016 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000085016
Domain Number 1 Region: 1780-2025
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.98e-54
Family Ankyrin repeat 0.0000000668
Further Details:      
 
Domain Number 2 Region: 799-931
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000596
Family Growth factor receptor domain 0.0094
Further Details:      
 
Domain Number 3 Region: 1110-1251
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000636
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 4 Region: 571-700
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000272
Family Growth factor receptor domain 0.0088
Further Details:      
 
Domain Number 5 Region: 268-437
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000277
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 6 Region: 470-511
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000286
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 7 Region: 431-474
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000005
Family EGF-type module 0.002
Further Details:      
 
Domain Number 8 Region: 508-551
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000268
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 9 Region: 921-963
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000914
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 10 Region: 237-280
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000237
Family EGF-type module 0.015
Further Details:      
 
Domain Number 11 Region: 1081-1124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000347
Family EGF-type module 0.01
Further Details:      
 
Domain Number 12 Region: 159-196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000121
Family EGF-type module 0.0031
Further Details:      
 
Domain Number 13 Region: 1338-1376
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000232
Family EGF-type module 0.017
Further Details:      
 
Domain Number 14 Region: 1249-1299
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000343
Family EGF-type module 0.011
Further Details:      
 
Domain Number 15 Region: 1468-1501
Classification Level Classification E-value
Superfamily Notch domain 0.0000000798
Family Notch domain 0.0035
Further Details:      
 
Domain Number 16 Region: 737-771
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000822
Family EGF-type module 0.01
Further Details:      
 
Domain Number 17 Region: 925-1041
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000129
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 18 Region: 198-241
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000318
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 19 Region: 121-164
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000007
Family EGF-type module 0.02
Further Details:      
 
Domain Number 20 Region: 45-79
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000105
Family EGF-type module 0.038
Further Details:      
 
Domain Number 21 Region: 1387-1419
Classification Level Classification E-value
Superfamily Notch domain 0.00000157
Family Notch domain 0.0014
Further Details:      
 
Domain Number 22 Region: 1427-1459
Classification Level Classification E-value
Superfamily Notch domain 0.00000248
Family Notch domain 0.0049
Further Details:      
 
Domain Number 23 Region: 1049-1089
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000536
Family EGF-type module 0.039
Further Details:      
 
Domain Number 24 Region: 693-733
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000109
Family EGF-type module 0.01
Further Details:      
 
Domain Number 25 Region: 775-810
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000177
Family EGF-type module 0.034
Further Details:      
 
Domain Number 26 Region: 81-120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00005
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000085016
Domain Number - Region: 1293-1328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0161
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000085016   Gene: ENSMUSG00000038146   Transcript: ENSMUST00000087723
Sequence length 2318
Comment pep:known chromosome:GRCm38:17:32120820:32166880:-1 gene:ENSMUSG00000038146 transcript:ENSMUST00000087723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLGARGRRRRRRLMALPPPPPPMRALPLLLLLAGLGAAAPPCLDGSPCANGGRCTHQQP
SLEAACLCLPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCLRGFQGPDCSQ
PDPCVSRPCVHGAPCSVGPDGRFACACPPGYQGQSCQSDIDECRSGTTCRHGGTCLNTPG
SFRCQCPLGYTGLLCENPVVPCAPSPCRNGGTCRQSSDVTYDCACLPGFEGQNCEVNVDD
CPGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNLLGGHS
CVCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSNP
CHEDAICDTNPVSGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQC
GRGYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAGFTGTYCEVDIDECQSSPCV
NGGVCKDRVNGFSCTCPSGFSGSMCQLDVDECASTPCRNGAKCVDQPDGYECRCAEGFEG
TLCERNVDDCSPDPCHHGRCVDGIASFSCACAPGYTGIRCESQVDECRSQPCRYGGKCLD
LVDKYLCRCPPGTTGVNCEVNIDDCASNPCTFGVCRDGINRYDCVCQPGFTGPLCNVEIN
ECASSPCGEGGSCVDGENGFHCLCPPGSLPPLCLPANHPCAHKPCSHGVCHDAPGGFRCV
CEPGWSGPRCSQSLAPDACESQPCQAGGTCTSDGIGFRCTCAPGFQGHQCEVLSPCTPSL
CEHGGHCESDPDRLTVCSCPPGWQGPRCQQDVDECAGASPCGPHGTCTNLPGNFRCICHR
GYTGPFCDQDIDDCDPNPCLHGGSCQDGVGSFSCSCLDGFAGPRCARDVDECLSSPCGPG
TCTDHVASFTCACPPGYGGFHCEIDLPDCSPSSCFNGGTCVDGVSSFSCLCRPGYTGTHC
QYEADPCFSRPCLHGGICNPTHPGFECTCREGFTGSQCQNPVDWCSQAPCQNGGRCVQTG
AYCICPPGWSGRLCDIQSLPCTEAAAQMGVRLEQLCQEGGKCIDKGRSHYCVCPEGRTGS
HCEHEVDPCTAQPCQHGGTCRGYMGGYVCECPAGYAGDSCEDNIDECASQPCQNGGSCID
LVARYLCSCPPGTLGVLCEINEDDCDLGPSLDSGVQCLHNGTCVDLVGGFRCNCPPGYTG
LHCEADINECRPGACHAAHTRDCLQDPGGHFRCVCHPGFTGPRCQIALSPCESQPCQHGG
QCRHSLGRGGGLTFTCHCVPPFWGLRCERVARSCRELQCPVGIPCQQTARGPRCACPPGL
SGPSCRVSRASPSGATNASCASAPCLHGGSCLPVQSVPFFRCVCAPGWGGPRCETPSAAP
EVPEEPRCPRAACQAKRGDQNCDRECNTPGCGWDGGDCSLNVDDPWRQCEALQCWRLFNN
SRCDPACSSPACLYDNFDCYSGGRDRTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLD
CASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDARGQAMVFPYH
RPSPGSESRVRRELGPEVIGSVVMLEIDNRLCLQSAENDHCFPDAQSAADYLGALSAVER
LDFPYPLRDVRGEPLEAPEQSVPLLPLLVAGAVFLLIIFILGVMVARRKREHSTLWFPEG
FALHKDIAAGHKGRREPVGQDALGMKNMAKGESLMGEVVTDLNDSECPEAKRLKVEEPGM
GAEEPEDCRQWTQHHLVAADIRVAPATALTPPQGDADADGVDVNVRGPDGFTPLMLASFC
GGALEPMPAEEDEADDTSASIISDLICQGAQLGARTDRTGETALHLAARYARADAAKRLL
DAGADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTDLDARMADGSTALILAARLAVE
GMVEELIASHADVNAVDELGKSALHWAAAVNNVEATLALLKNGANKDMQDSKEETPLFLA
AREGSYEAAKLLLDHLANREITDHLDRLPRDVAQERLHQDIVRLLDQPSGPRSPSGPHGL
GPLLCPPGAFLPGLKAVQSGTKKSRRPPGKTGLGPQGTRGRGKKLTLACPGPLADSSVTL
SPVDSLDSPRPFSGPPASPGGFPLEGPYATTATAVSLAQLGASRAGPLGRQPPGGCVLSF
GLLNPVAVPLDWARLPPPAPPGPSFLLPLAPGPQLLNPGAPVSPQERPPPYLAAPGHGEE
YPAAGTRSSPTKARFLRVPSEHPYLTPSPESPEHWASPSPPSLSDWSDSTPSPATATNAT
ASGALPAQPHPISVPSLPQSQTQLGPQPEVTPKRQVMA
Download sequence
Identical sequences Q61982
ENSMUSP00000085016 ENSMUSP00000085016 ENSMUSP00000085016 NP_032742.1.92730 10090.ENSMUSP00000085016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]