SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000086048 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000086048
Domain Number 1 Region: 7-176
Classification Level Classification E-value
Superfamily Caspase-like 3.58e-26
Family Caspase catalytic domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000086048   Gene: ENSMUSG00000067882   Transcript: ENSMUST00000088673
Sequence length 176
Comment pep:known chromosome:GRCm38:17:23551073:23553488:-1 gene:ENSMUSG00000067882 transcript:ENSMUST00000088673 gene_biotype:polymorphic_pseudogene transcript_biotype:protein_coding
Sequence
MAHREPQGQLLGGDGQEVQAEVLVQELSCCQALHGHPKIFLLQVCCGGNRDPGVGSRALP
WYRHWLRAPRAIPTQADVLQIHADAPGGSAFLLEPGLGTQVLGTIHSCVAYRDEKGSDFV
QTLVEVIRANPGRDLLELLTEVNRRVCELDVLGPDSDELCKACLEIRSLLRRRLCL
Download sequence
Identical sequences I6L890
ENSMUSP00000086048 ENSMUSP00000086048 ENSMUSP00000086048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]