SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000087119 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000087119
Domain Number 1 Region: 314-508
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.62e-69
Family Hemopexin-like domain 0.0000118
Further Details:      
 
Domain Number 2 Region: 115-284
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.82e-55
Family Matrix metalloproteases, catalytic domain 0.0000000268
Further Details:      
 
Domain Number 3 Region: 26-98
Classification Level Classification E-value
Superfamily PGBD-like 4.71e-19
Family MMP N-terminal domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000087119   Gene: ENSMUSG00000000957   Transcript: ENSMUST00000089688
Sequence length 582
Comment pep:known chromosome:GRCm38:14:54431604:54441258:1 gene:ENSMUSG00000000957 transcript:ENSMUST00000089688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPAPRPSRSLLLPLLTLGTALASLGWAQGSNFSPEAWLQQYGYLPPGDLRTHTQRSPQS
LSAAIAAMQKFYGLQVTGKADLATMMAMRRPRCGVPDKFGTEIKANVRRKRYAIQGLKWQ
HNEITFCIQNYTPKVGEYATFEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIL
FAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVQNEDLNGNDIFLVAVHE
LGHALGLEHSNDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGSKSGSPTKMPPQPRTT
SRPSVPDKPKNPAYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQF
WRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALF
WMPNGKTYFFRGNKYYRFNEEFRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKG
NKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGSGAVSAA
AVVLPVLLLLLVLAVGLAVFFFRRHGTPKRLLYCQRSLLDKV
Download sequence
Identical sequences P53690
ENSMUSP00000087119 NP_032634.3.92730 ENSMUSP00000087119 ENSMUSP00000087119 10090.ENSMUSP00000087119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]