SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000088447 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000088447
Domain Number 1 Region: 974-1027
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000315
Family SH3-domain 0.0022
Further Details:      
 
Domain Number 2 Region: 616-793
Classification Level Classification E-value
Superfamily RUN domain-like 0.00000000719
Family RUN domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000088447   Gene: ENSMUSG00000041263   Transcript: ENSMUST00000090929
Sequence length 1030
Comment pep:known chromosome:GRCm38:3:89083981:89093363:-1 gene:ENSMUSG00000041263 transcript:ENSMUST00000090929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSPQRALLCNLNHIHLQHVSLGLHLSRRPELREGPLSTPPPPGDTGGKESRGPCSGTLV
DANSNSPAVPCRCCQEHGSSIENQQDPSQEEEAVSPSDPGCSSSLSSCSDLSPDESPVSV
YSRDLPGNEDANPQPSTLELGSPLAPAGPSTCSPDSFCCSPDSCSGISSPPGPDLDSNCN
ALTTCQDLPSPGLEEEEDSGEQDLATSELSETEDGRIDAGKAEPSWKINPIWKIDTEKTE
AGWKTIEDSDSGRKTDENTNSSLKTESGKLASCLNTNSGSKIDAGKTDGGWRGDVSQEPV
PHRTITSFHELAQKRKRGPGLPLVPQAKKDRSDWLIVFSPDTELPPTGSLGGSLAPPREV
TTFKELRSRSRAQPPPVPPRDPPAGWALVPPRPPPPPVPPRRKKNRLGLQPIAEGLSEEG
RAASPRAGEEASASQEPEEPRAHAVAGPSLFPRPPVFRFSADGRPLLEGGGAGAPGSLLF
TPLTGWSNSRLRLLGAASPPEEQLLPVRLSPVGAYSPPTRGALPCLASPELALLLSPLFP
RSSTFPAAAPLPRQVPAPPLPTPPCPPTAPRWTRRPPPPPRQLRSSWSFAGVPGAQRLWM
AEAQSGTGQLQEQKKGLLIAVSASVDKIISHFGAARNLVQKAQLGDSRLSPDVGHLVLTT
LCPALHALVADGLKPFRKDLITGQRRSSPWSVVEASVKPGSCTHSMGSLYSQVSRLAPLS
SSRSRFHAFILGLLNTKQLELWFSSLQEDAGLLSLLYLPTGFFSLARGSCPSLATELLLL
LQPLSVLTFHLDLLFEHHHHLPVGLQQAPAPSCPPPALQQTMQAVLHWGERLAQSLRGTS
GESTTDSSTPSARPPAGSWWDQLTQASRVYASGGTEGFPLLRWGPRRHGTTAEAAQEAPP
PTEQTTPGRSVWLGRLFGVPGCPSETESGAFKSRRPSSWLPPTVSVLALVKRGTPPETPP
EALVSSPGSVVQADRAVRALCDHTAAGPDQLSFQRGELLRVIATVDEDWLRCGRDGVEGL
VPVGYTSLVL
Download sequence
Identical sequences ENSMUSP00000088447 NP_082464.2.92730 ENSMUSP00000088447 10090.ENSMUSP00000088447 ENSMUSP00000088447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]