SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000088680 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000088680
Domain Number 1 Region: 809-1206
Classification Level Classification E-value
Superfamily Ras GEF 1.07e-100
Family Ras GEF 0.0000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000088680   Gene: ENSMUSG00000039844   Transcript: ENSMUST00000091146
Sequence length 1218
Comment pep:novel chromosome:GRCm38:2:29619741:29740363:1 gene:ENSMUSG00000039844 transcript:ENSMUST00000091146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGLGLRRSPEMSGKIEKADSQRSHLSSFTMKLMDKFHSPKIKRTPSKKGKPAEVSKIP
EKPVSKNLCWLEEKEKEVVSALRYFKTIVDKMAIDKKVLEMLPGSASKVLEAILPLVQTD
PRIQHSSALSSCYSRVYQSLANLIRWSDQVMLEGVNSEDKEMVTTVKGVIKAVLDGVKEL
VRLTIEKQGRPSPTSPVKPSSPASKPDGQPELPLTDREMEILNKTTSVSPSAELLPDSTS
EEVAPPKPPLPGIRVVDNSPPALPPKKRQSAPSPTRVAVVAPMSRATSGSSLPVGINRQD
FDVECYTQRRLSGGSRSCGGESPRLSPCSSTGKLSRSDEQLSSLDRDSGQCSRNTSCETL
DHYDPDYEFLQQDLSNADQIPPQAACNLSPLPESLGESGPPFLGHPFQLPLGSCLQQEGQ
QTDTPPALPEKKRRSAVSQTTDSSGCRVSYERHPSQYDNISEGDLQNPVPVQPVPYPPFA
AVLPFQQGASSASAEFVGDFSVPELAGDTEKPPPLPEKKNKHMLAYMQLLEDYSEPQPSM
FYQTPQSEHIYQQKNKMLMEVYGFSESFCGSDSTQELAPPPALPPKQRQLQASYAASSFS
VSYCVQQTKVAFTPEDGSAAQGLSVSVSNSFLNRHGSLPVPSYKSVFRSYSQDFMPHHQA
SVQPFLPPTSSSSPHFPPVHTSQSSDLAVPTVSSPPPSTVDGPLSSSQDSSFHGNPVRLP
SETSFTDSSEKASSEEAGGDEYVSLYSSGQTSEELAPCRGEPPSGKDGHPRDPSVSSASG
KDSRENGERSPKSLDGLESAQSEEEVDELSLIDHNEIMARLTLKQEGDDGPDVRGGSGDI
LLVHATETDRKDLVLYCEAFLTTYRTFISPEELIKKLQYRYEKFSPFADTFKKRVSKNTF
FVLVRVVDELCLVELTEEILKLLMELVFRLVCSGELSLARVLRKNILDKVDQKKLLRCAH
SDQPLAARGVAARPGTLHDFHSHEIAEQLTLLDAELFYKIEIPEVLLWAKEQNEEKSPNL
TQFTEHFNNMSYWVRSIIMLQEKAQDRERLLLKFIKIMKHLRKLNNFNSYLAILSALDSA
PIRRLEWQRQTSEGLAEYCTLIDSSSSFRAYRAALSEVEPPCIPYLGLILQDLTFVHLGN
PDYIDGKVNFSKRWQQFNILDSMRCFQQAHYEIRRNDDIINFFNDFSDHLAEEALWELSL
KIKPRNITRRKTDREEKT
Download sequence
Identical sequences Q3UGX8
ENSMUSP00000088680 NP_001034175.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]