SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000089801 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000089801
Domain Number 1 Region: 19-147
Classification Level Classification E-value
Superfamily Lysozyme-like 2.95e-56
Family C-type lysozyme 0.000000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000089801   Gene: ENSMUSG00000069516   Transcript: ENSMUST00000092163
Sequence length 148
Comment pep:known chromosome:GRCm38:10:117277334:117282274:-1 gene:ENSMUSG00000069516 transcript:ENSMUST00000092163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTLLTLGLLLLSVTAQAKVYERCEFARTLKRNGMAGYYGVSLADWVCLAQHESNYNTRA
TNYNRGDQSTDYGIFQINSRYWCNDGKTPRAVNACGINCSALLQDDITAAIQCAKRVVRD
PQGIRAWVAWRAHCQNRDLSQYIRNCGV
Download sequence
Identical sequences A0A077S2U6 A0A1S3R3U2 P08905
ENSMUSP00000089801 ENSMUSP00000089801 ENSMUSP00000089801 NP_059068.1.92730 XP_014046806.1.97760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]