SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000090212 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000090212
Domain Number 1 Region: 101-143
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000017
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 2 Region: 26-62
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000812
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 3 Region: 181-218
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000314
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 4 Region: 221-259
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 5 Region: 263-300
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000458
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 6 Region: 61-100
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000982
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 147-180
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000511
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 8 Region: 347-382
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000019
Family EGF-type module 0.0083
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000090212
Domain Number - Region: 315-354
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000103
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000090212   Gene: ENSMUSG00000027070   Transcript: ENSMUST00000092551
Sequence length 426
Comment pep:known chromosome:GRCm38:2:69526366:69586029:-1 gene:ENSMUSG00000027070 transcript:ENSMUST00000092551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERGAAAAAWMLLLAIAACLAPVSGQECGSGNFRCDNGYCIPASWRCDGTRDCLDDTDEI
GCPPRSCGSGFFLCPAEGTCIPSSWVCDQDKDCSDGADEQQNCPGTTCSSQQLTCSNGQC
VPIEYRCDHVSDCPDGSDERNCYYPTCDQLTCANGACYNTSQKCDHKVDCRDSSDEANCT
TLCSQKEFQCGSGECILRAYVCDHDNDCEDNSDEHNCNYDTCGGHQFTCSNGQCINQNWV
CDGDDDCQDSGDEDGCESNQRHHTCYPREWACPGSGRCISMDKVCDGVPDCPEGEDENNA
TSGRYCGTGLCSILNCEYQCHQTPYGGECFCPPGHIINSNDSRTCIDFDDCQIWGICDQK
CESRQGRHQCLCEEGYILERGQHCKSNDSLLGIEPKATSLRFSPETGFFFVWPWLSWNSL
GFPGWR
Download sequence
Identical sequences Q3V346
ENSMUSP00000090212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]