SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000090406 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000090406
Domain Number - Region: 47-137
Classification Level Classification E-value
Superfamily EndoU-like 0.0745
Family Nsp15 C-terminal domain-like 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000090406   Gene: ENSMUSG00000069733   Transcript: ENSMUST00000092730
Sequence length 239
Comment pep:putative chromosome:GRCm38:4:100478867:100550145:1 gene:ENSMUSG00000069733 transcript:ENSMUST00000092730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLSYPVLKNPVNLEAAQLLIRNASTYKMVIQELLPPALPKRESSLVIPEKPQDRVRVIK
TISFNDYYKTWSQIATTKVAEHSRNPFVGDPHFMGQYYKWKQQDRQNQVQWESKFALSKW
QTARKKIMAQEKSNHYNQVIGIYPSPSELSFEYEIEEEEEEEEEEEEEEEEEEEEEEKEE
EEEEPRIYQIPQEWPEEHDSKESWEEEADHLVSWTNGLDEESLNYEYFDNVKNYENLGN
Download sequence
Identical sequences Q3V081
ENSMUSP00000090406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]