SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000090828 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000090828
Domain Number 1 Region: 35-419
Classification Level Classification E-value
Superfamily Ras GEF 3.79e-98
Family Ras GEF 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000090828   Gene: ENSMUSG00000020374   Transcript: ENSMUST00000093141
Sequence length 425
Comment pep:novel chromosome:GRCm38:11:49901835:49980222:1 gene:ENSMUSG00000020374 transcript:ENSMUST00000093141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRTLTASDMVTPGSLSPPPTESTEGEQAGQPLLDGAPSSASLDTLIQHLVPTADYYPEA
RVRKFGAKLLQLLAEWTETFPRDFEEESTIGHLTDVVGRISPCDETYGSRVHQLLQTLHQ
KLASLGQGPESLVGADKPISYRTKPPASIHRELLGVCSDPYTLAQQLTHVELERLRHIGP
EEFVQAFVNKDPLAGTKPRFSDKTNNVEAYVKWFNRLCYLVATEICMPAKKKQRAQVIEF
FIDVARECFNIGNFNSLMAIISGMNMSPVSRLKKTWAKVKTAKFFILEHQMDPTGNFCNY
RTALRGAAHRSLTAHSSREKIVIPFFSLLIKDIYFLNEGCANRLPNGHVNFEKFLELAKQ
VGEFITWKQVECPFEQDPSITHYLYTAPIFSEDGLYLASYESESPESQTEKERWKSLRSS
ILGKT
Download sequence
Identical sequences B1ATE5
ENSMUSP00000090828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]