SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000090897 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000090897
Domain Number 1 Region: 1-142
Classification Level Classification E-value
Superfamily Globin-like 1.96e-49
Family Globins 0.000000497
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000090897   Gene: ENSMUSG00000069919   Transcript: ENSMUST00000093209
Sequence length 142
Comment pep:known chromosome:GRCm38:11:32283511:32284465:1 gene:ENSMUSG00000069919 transcript:ENSMUST00000093209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHG
KKVADALANAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTP
AVHASLDKFLASVSTVLTSKYR
Download sequence
Identical sequences Q91VB8
ENSMUSP00000090895 ENSMUSP00000090897 ENSMUSP00000090895 ENSMUSP00000090897 ENSMUSP00000090895 ENSMUSP00000090897 10090.ENSMUSP00000090895 10090.ENSMUSP00000090897 NP_001077424.1.92730 NP_032244.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]