SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000091238 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000091238
Domain Number 1 Region: 36-276
Classification Level Classification E-value
Superfamily Caspase-like 1.64e-93
Family Caspase catalytic domain 0.000000000892
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000091238   Gene: ENSMUSG00000031628   Transcript: ENSMUST00000093517
Sequence length 277
Comment pep:known chromosome:GRCm38:8:46617449:46638706:1 gene:ENSMUSG00000031628 transcript:ENSMUST00000093517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENNKTSVDSKSINNFEVKTIHGSKSVDSGIYLDSSYKMDYPEMGICIIINNKNFHKSTG
MSSRSGTDVDAANLRETFMGLKYQVRNKNDLTREDILELMDSVSKEDHSKRSSFVCVILS
HGDEGVIYGTNGPVELKKLTSFFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSGTDE
EMACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCSMLKLYAHKLEFMHILTRVN
RKVATEFESFSLDSTFHAKKQIPCIVSMLTKELYFYH
Download sequence
Identical sequences P70677
ENSMUSP00000091238 ENSMUSP00000091238 ENSMUSP00000091238 10090.ENSMUSP00000091238 NP_001271338.1.92730 NP_033940.1.92730 XP_017168032.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]