SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000091330 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000091330
Domain Number 1 Region: 909-1199
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.47e-81
Family Complement components 0.0000139
Further Details:      
 
Domain Number 2 Region: 1282-1401
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 1.57e-29
Family Alpha-macroglobulin receptor domain 0.0013
Further Details:      
 
Domain Number 3 Region: 744-800
Classification Level Classification E-value
Superfamily E set domains 0.0000000826
Family SVA-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000091330   Gene: ENSMUSG00000046186   Transcript: ENSMUST00000093812
Sequence length 1442
Comment pep:known chromosome:GRCm38:9:78615546:78716253:1 gene:ENSMUSG00000046186 transcript:ENSMUST00000093812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSRRLLSAAHLLCLCAVALAAPGSRFLVTAPGIIRPGANVTIGVDLLENSPPQVLVKAQ
VFKIASNKSRSILEAEGVFHRGHFKTLVLPALPLSSADKIYELHINGQSENEIVFSNRTR
LTFESKSISVLIQTDKAFYKPKQEVKFRVLTLCSDLKPYRTSVDIFIKDPKSNVIQQWFS
QKGDLGVVSKTFQLSSNPIFGDWSIQVQVNDQQYYQSFQVLEYVLPKFEVTVQTPLYCSL
KSKQLNGSVIAKYTYGKPVKGSLSLTFLPLSFWGKKKNITKSFEINGFANFSFDNYEMKK
VMNLKPLTDVSEGSYENVDPSFPGPAEIIATVTESLTGISRMASTNVFFKQHDYIIEIFD
YTTVLKPSLNFTATVKVSRSDGNQLTPEEIENDLVTVVTQRKNNHPESQRDQEMDYIQTV
NYTIPQNGIIKIEFPVMSISGELQLKAYFLDGTSSVTVHSMFTSPSKTYIQLKTRDEYIK
VGSPFDLMVSGNRQFKDLSYMVISKGQLVAAGKQSSRTFSLTPEASWAPKACIIAYYIAE
DGEIINDILKIPVQLVFENKVKLFWSKPTVKPSDKVSLRISATQSDSLVGIVAVDKSVTL
MENSNSITMETMVHELELYNTEYYLGMFMNSFAVFQECGLWVLTDATLIRDSIDEVYDTE
EYSERFAEENEANLVDFEDASSVNNVHVRKNFPETWIWLDAYMGSKIYEEFEVTVPDSIT
SWVASAFVISEDLGFGLTTVPAELQAFQPFFLFLNLPYSVIRGEEFALEVSIVNYLKDTI
KVVILIEESDSFDILMTSNDTNGTIYRKTVQVPRDNGVTLVFPIKPTHLGEIPITVTAAS
PTASDAVTQTIVVKPEGIEKSYSKSVLLDLTDSNVESKQQSMRFSFPPDTVIGSERVQIT
AIGDILGSSINGLSSLIRMPYGCGEQNMIYFAPNIYILDYLTKQKQLTVNLKEKALSYMR
QGYQRELLYQREDGSFSAFGDIDSSGSTWLSAFVLRCFLEADYYIDIDQDVLHRTYTWLN
AHKKFNGEFWEPGRVIHSELQGGTKSPVTLTAYIVTSVLGYKKYQPNIDVQDSIKFLEFE
FSRGISDNYTLAIISYALSTVGSPKAEEALNLLMQRSEKEGDTQFWLSSGPALSGSWQPR
SVDIEIAAYALLAHTLHHVSEGIPVMRWLIQQRNSLGGFVSTQDTVVALKALSEFSALVH
KENTDIQLTVTGPGIPRSIHFRIDSQNLFLLHQEELHALDPITVNVSAHGSGFAICQLNV
DYNVKGSGSSKRRRSTENQEVFDLDVIVNNEDDISHLNLNVCTSHLGSERTGMVLMEVNL
LSGFSASSDSIPLSETLKKVEYDNGKLNLYLDSVNESQFCVNIPTVRDYKVSNIRDGSVS
VMDYYEPRRQAVRSYNTQVKLSSCYLSPDTNCKSHTDGATDSLRRSSSLLVFCSVLLYFV
QH
Download sequence
Identical sequences A6MDD3 Q8R422
ENSMUSP00000091330 NP_694738.1.92730 ENSMUSP00000091330 ENSMUSP00000091330 10090.ENSMUSP00000091330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]