SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000091423 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000091423
Domain Number 1 Region: 315-506
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.27e-62
Family Hemopexin-like domain 0.000000676
Further Details:      
 
Domain Number 2 Region: 119-179,207-302
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.53e-48
Family Matrix metalloproteases, catalytic domain 0.00000791
Further Details:      
 
Domain Number 3 Region: 46-110
Classification Level Classification E-value
Superfamily PGBD-like 5.18e-19
Family MMP N-terminal domain 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000091423   Gene: ENSMUSG00000101577   Transcript: ENSMUST00000093896
Sequence length 551
Comment pep:known chromosome:GRCm38:9:7571458:7581393:1 gene:ENSMUSG00000101577 transcript:ENSMUST00000093896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPYKQKQALTEETGMKCLLSLMVNFITLSAAFPPDRKDKNEENNQLAQAYLNQFYSLEIE
GSHFVQSKNRSLFDGKLREMQAFFGLTVTGKLDSDTLAIMKVPRCGVPDVGQYGYTLPGW
RKYSLTYRIMNYTPDMTPADVDEAIQKALQVWSKVTPLTFTRISKGVADIMIAFRTGGKA
CSEGSDFFEDHRELTYLPINCLSVHGWCPRHFDGPLGVLGHAFPPGLGLGGDTHFDEDET
WIAKDGEGFNLFLVAAHEFGHSLGLSHSNDQTALMFPNYISLDPSKYPLSQDDIDGIQSI
YGSPPKVTTKPSGNSEPHACDPTLTFDAITTFRREVMFFKGRHLWRVYSDIAGAEFEFID
SFWPSLPADLQAAYESPRDELLVFKDENFWVIRGYSVLPGYPKSIHTLGFPRRVKKIDAA
VCDHDTRKTFFFVGIWCWRYDEMAQAMDRGFPQRIIKCFPGIRLRVDAVFQHNGFLYFFH
GSRQFEYDMKAKNITQVIKTNSWFLCNEPLNASFNVSVKGKANSIGTVILHHKRLSLLTF
SIVHVLTKTYN
Download sequence
Identical sequences D3YV89
ENSMUSP00000091423 ENSMUSP00000117469 ENSMUSP00000113231 ENSMUSP00000091423 10090.ENSMUSP00000117469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]