SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000092828 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000092828
Domain Number 1 Region: 4-412
Classification Level Classification E-value
Superfamily Ras GEF 7.06e-102
Family Ras GEF 0.00024
Further Details:      
 
Domain Number 2 Region: 484-544
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.74e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00086
Further Details:      
 
Domain Number 3 Region: 418-503
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000156
Family Calmodulin-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000092828   Gene: ENSMUSG00000071042   Transcript: ENSMUST00000095204
Sequence length 691
Comment pep:known chromosome:GRCm38:17:75465538:75529043:1 gene:ENSMUSG00000071042 transcript:ENSMUST00000095204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSNGLGKAATLDELLSTCIEMFDDNGDLNDSYLPRIVLLMHRWYLSSTELAGKLLCMYR
NASGESCDEFRLKICYFMRYWILKFPAEFNLDLGLIRMTEEFREVASQLGHEKHISLMDI
SSVPSYDWMRRVTQRKKVSKRGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDYQSYV
IHGCLENNPTLERSIALFNGISKWVQLMVLSKPSAQQRAEVITKFINVAQKLLQLKNFNT
LMAVVGGLSHSSISRLKDTHSHLSSEVTKNWNEMTELVSSNGNYCNYRKAFADCDGFKIP
ILGVHLKDLIAVHVIFPDWMEENKVNVVKMHQLSVTLSELVSLQNASHHLEPNMDLINLL
TLSLDLYHTEDDIYKLSLVLEPRNSKSQPTSPTTPNKPVVPLEWASEVVPKPDPTIINKH
IRKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAYFLR
AKSQLHCKMGPGFIHNFQEMNYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLL
VLACRRLARAPSLSSNPGSLPGSPALPPVQDEVFEFPGVTAGHRDLDSRAITLVTGSSRK
ISVRLQRATTSQATQTEPVWSEAVWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPTV
QAGVDVVDRGTAFEPDQDDGQDEAKQGGEDG
Download sequence
Identical sequences Q6NZH9
NP_001159965.1.92730 NP_997129.1.92730 XP_006524334.1.92730 XP_006524335.1.92730 10090.ENSMUSP00000092828 ENSMUSP00000092828 ENSMUSP00000092828 ENSMUSP00000129393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]