SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000092904 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000092904
Domain Number 1 Region: 550-668
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000255
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000092904   Gene: ENSMUSG00000040441   Transcript: ENSMUST00000095270
Sequence length 684
Comment pep:known chromosome:GRCm38:10:127172426:127180645:-1 gene:ENSMUSG00000040441 transcript:ENSMUST00000095270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQGAKDKMSGPLASGTCSDPEEVSDLKSPLSSRFREPLTHARFQELFGGAEPEPELPAE
PCLPCLCRLRRRRASACSGPGAWRVLLARLPPLRWLPQYRWRAWLLGDAVAGVTVGVVHV
PQGMAFALLTSVPPVFGLYTSFFPVLIYSLLGTGRHLSTGTFAVLSLMTGSVVERVVPEP
LAGNLSGIEREQLEARRVGAAAAVAFGSGALMLGMFVLQLGVLSTFLSEPVIKALTSGAA
LHVLVSQLPSLLGLSLPRQIGCFSLFKTLAAVLSALSQSSPAEVTISALSLVLLVPVKEL
NVRFRDRLLTPIPGEVVMVLLATVLCFTSSLDTRYNVQVVGPLPGGFPQPLLPTLDELPR
ILADSLPISLVTFAVSTSLASIYADKYSYTIEPNQELLAHGVSNLISSLFSCFPNSATLA
TTSLLVDAGGNTQLAGLFSCAVVLAALLWLRPFFYYLPKAVLACINISSMRQMFFQMQEL
PQLWHISHVDFAVWIVTWVAVVTLNVDLGLAVGVVVSMMTVVCRTQRVQCLELGLAEGTE
LYRPIRESRKLLQVPGLCILSYPAPLYFATRGQFHRILEWHLGLGERIKPGAEPVRVAIL
DFSGITFVDAAGAREVVQLTRRCQDDGIYLLLAQCNALVLETLTRARLLDSVSPEQLFVS
VQDAAAHALERLKPTGPKICTVWV
Download sequence
Identical sequences F8WGV3
NP_808283.2.92730 ENSMUSP00000092904 ENSMUSP00000092904 ENSMUSP00000092904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]