SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000093197 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000093197
Domain Number 1 Region: 720-777
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.61e-16
Family Complement control module/SCR domain 0.00087
Further Details:      
 
Domain Number 2 Region: 26-66
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000157
Family Somatomedin B domain 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000093197
Domain Number - Region: 62-135
Classification Level Classification E-value
Superfamily E set domains 0.00756
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000093197   Gene: ENSMUSG00000006342   Transcript: ENSMUST00000095541
Sequence length 820
Comment pep:known chromosome:GRCm38:10:75636619:75644008:-1 gene:ENSMUSG00000006342 transcript:ENSMUST00000095541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLALLPWILMLLSTIPGPGFTAGAQGSCSLRCGAQDGLCSCHPTCSGLGTCCEDFLDYC
LEILPSSGSMMGGKDFVVQHLKWTDPTDGVICRFKESIQTLGYVDDFYQVHCISPLLYES
GYIPFTISMDNGRSFPHAGTWLAAHPYKVSESEKSQLVNETHWQYYGTSDTRGNLNLTWD
TSALPTPAVTIELWGYEETGKPYSGNWTSKWSYLYPLATNIPNTGFFTFTPKPASPQYQR
WKVGALRISSSRNYPGEKDVRALWTNDHALAWHLGDDFRADSVAWARAQCLAWEALEDQL
PNFLTELPDCPCTLAQARADSGRFFTDYGCDIEHGSVCTYHPGAVHCVRSVQASPRYGSG
QQCCYTAAGTQLLTSDSTSGSTPDRGHDWGAPPYRTPPRVPGMSHWLYDVISFYYCCLWA
PECPRYMKRRPSSDCRNYRPPRLASAFGDPHFVTFDGTSFSFSGNGEYVLLETTLSDLRV
QGRAQPGRMPNGTQARGTGLTAVAVQEDNSDVIEVRLAGGSRVLEVLLNQKVLSFTEQNW
MDLKGMFLSVAAQDKVSIMLSSGAGLEVGVQGPFLSVSILLPEKFLTHTRGLLGTLNNNP
RDDFTLRNGQVLPLNASAQQVFQFGADWAVSNTSSLFTYDSWLLVYQFVYGPKHNPNFKP
LFPDETTLSPSQTEDVARLCEGDRFCILDVMSTGSSSVGNATRIAHQLHQHRLKSLQPVV
SCGWLPPPANGHKEGLRYLEGSVVRFSCNNGYSLVGPESSTCQADGKWSMPTPECQPGRS
YTVLLSIIFGGLAIVALISIIYMMLHRRRKSNMTMWSSQP
Download sequence
Identical sequences Q9DBX3
ENSMUSP00000093197 ENSMUSP00000093197 NP_082166.3.92730 ENSMUSP00000093197 10090.ENSMUSP00000093197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]