SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000093382 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000093382
Domain Number 1 Region: 149-255
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000432
Family cAMP-binding domain 0.015
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000093382
Domain Number - Region: 247-277
Classification Level Classification E-value
Superfamily ISY1 domain-like 0.0654
Family ISY1 N-terminal domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000093382   Gene: ENSMUSG00000071317   Transcript: ENSMUST00000095715
Sequence length 358
Comment pep:known chromosome:GRCm38:10:45335762:45369708:1 gene:ENSMUSG00000071317 transcript:ENSMUST00000095715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSTESIPLAQSTVAGFTSELESLTPVPSNETTCENWREIHHLVFHVANVCFAVGLLIPT
TLHLHMILLRVMLSLGCTLYVVWATLYRCALDVMIWNSVFLGINILHLSYLLYKKRPVKI
EKELGGVYHRLFEPLRVPPDLFRRLTGQFCMIQTLKRGQVYATEDKTSVDDRLSILLKGR
MKVSYRGHFLHNIYPCAFIDSPEFRSTQMHKGEKFQVTIVADDNCRFLCWSRERLTYFLE
SEPFLYEIFRYLIGKDITNKLYSLNDPTLNDKKVKKLEPQMSLCTQISMLEMRNSITSSS
DGEDGLHHFLRGSSSTASLPMSSPQQRASAKMKPIEEGVEDDDEVFVSPDALKVHQLP
Download sequence
Identical sequences Q9ES83
ENSMUSP00000093382 ENSMUSP00000093382 ENSMUSP00000093382 NP_077247.1.92730 XP_006512799.1.92730 XP_006512800.1.92730 10090.ENSMUSP00000093382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]