SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000093795 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000093795
Domain Number 1 Region: 1-97
Classification Level Classification E-value
Superfamily Cystatin/monellin 2.76e-30
Family Cystatins 0.0000461
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000093795   Gene: ENSMUSG00000034362   Transcript: ENSMUST00000096090
Sequence length 97
Comment pep:known chromosome:GRCm38:16:36119946:36131241:-1 gene:ENSMUSG00000034362 transcript:ENSMUST00000096090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPGGLTEARPATAEVQEIADRVKAQLEEETNEKYEIFKAVEYKTQVVAGVNYFIKMDVG
GGCFTHIKVFKDLSGKNNLELTGYQTNKTEDDELTYF
Download sequence
Identical sequences B2RT71 P56567
ENSMUSP00000093795 ENSMUSP00000093795 10090.ENSMUSP00000093795 NP_001028411.1.92730 ENSMUSP00000093795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]