SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000095322 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000095322
Domain Number 1 Region: 25-109
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.5e-20
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000095322   Gene: ENSMUSG00000025208   Transcript: ENSMUST00000097715
Sequence length 159
Comment pep:known chromosome:GRCm38:19:45005014:45006442:-1 gene:ENSMUSG00000025208 transcript:ENSMUST00000097715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGRGTSSRFLTSVLHNGLGRYVQQLQRLSLSLSRDAPSSRGAREFVEREVTDFARRNPG
VVVYVNPRPCAMPRIVAEYLNGAVREENVNSKSVEEIKSLVQKLADQSGLDVIRIRKPFH
TDNPSIQGQWHPFTNKRTALHGLRPRELRDSAPASMQAQ
Download sequence
Identical sequences Q5RL20
ENSMUSP00000095322 ENSMUSP00000095322 NP_444394.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]