SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000095794 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000095794
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily Globin-like 2.89e-53
Family Globins 0.000000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000095794   Gene: ENSMUSG00000073940   Transcript: ENSMUST00000098192
Sequence length 147
Comment pep:known chromosome:GRCm38:7:103812524:103813996:-1 gene:ENSMUSG00000073940 transcript:ENSMUST00000098192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHLTDAEKAAVSGLWGKVNADEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNAK
VKAHGKKVITAFNDGLNHLDSLKGTFASLSELHCDKLHVDPENFRLLGNMIVIVLGHHLG
KDFTPAAQAAFQKVVAGVAAALAHKYH
Download sequence
Identical sequences A8DUK4 D0U281
ENSMUSP00000023934 ENSMUSP00000095794 ENSMUSP00000023934 ENSMUSP00000095794 ENSMUSP00000023934 ENSMUSP00000095794 NP_001188320.1.92730 NP_032246.2.92730 10090.ENSMUSP00000023934 10090.ENSMUSP00000095794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]