SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000096436 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000096436
Domain Number 1 Region: 147-184
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000277
Family Forkhead DNA-binding domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000096436   Gene: ENSMUSG00000074397   Transcript: ENSMUST00000098837
Sequence length 223
Comment pep:known chromosome:GRCm38:9:44434234:44440868:-1 gene:ENSMUSG00000074397 transcript:ENSMUST00000098837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNECFLTFTTTHLSEAEQKLALYRLQLVEPPKLPLEKKTNPDKDGPDIKPNLWMWVNPN
MVYPPGKLEVAVKEEDQSALSAFQPALKEEEDSCSEASEVQQPLPPCRQKRKQRRSTVPL
PLAPGRRAPLENPWRLPQAISPEGRLWSRPPLHYFHLIALALRNSPPCGLSVQQIYSFTR
QNICLLSAQEHNHSYPFATYNPAVPQIPILLGRYSFSYPVPKD
Download sequence
Identical sequences ENSMUSP00000096436 NP_001028641.1.92730 ENSMUSP00000096436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]