SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000096456 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000096456
Domain Number 1 Region: 127-304
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 5.1e-44
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.00054
Further Details:      
 
Domain Number 2 Region: 66-127
Classification Level Classification E-value
Superfamily TGS-like 0.000000000000327
Family TGS domain 0.0042
Further Details:      
 
Domain Number 3 Region: 283-345
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 0.000000058
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0039
Further Details:      
 
Domain Number 4 Region: 347-420
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 0.00000058
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000096456   Gene: ENSMUSG00000028107   Transcript: ENSMUST00000098857
Sequence length 423
Comment pep:known chromosome:GRCm38:3:95743853:95754977:-1 gene:ENSMUSG00000028107 transcript:ENSMUST00000098857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLCLRWRRLGFPLPEFRRCELHTVREASAPTPPHWLAERFGLFEELWTAHVKKLASMTQ
KKARAIKISLPEGQKVDAVAWNTTPYQLAHQISVTLADTAVAAEVNGELYDLDRPLETDC
HLRFLTFDSPEGKAVFWHSSAHVLGAAAEQQLGAVLCRGPSTESGFYHDFFLGKERTVRS
AELPILERICQELIAAAQPFRRLEASRDQLRQLFKDNHFKLHLIEEKVTGPTATVYGCGM
SVDLCRGPHLRHTGQIGALKLLTNSSALWRSLGAPETLQRVSGISFPKVELLRNWEARRE
AAELRDHRRIGKEQELFFFHELSPGSCFFLPRGTRVYNALVAFIRLEAEIQGCLDFLRCV
YSVLGFSFHLALSTRPPGFLGEPRLWDQAEQVLQQALEKFGEPWDLNPGDGAFYGPKASW
SHT
Download sequence
Identical sequences Q3TP97
ENSMUSP00000096456 NP_001157091.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]