SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000096476 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000096476
Domain Number 1 Region: 13-97
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.94e-30
Family Nuclear receptor 0.0000979
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000096476
Domain Number - Region: 300-335
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.000233
Family Nuclear receptor ligand-binding domain 0.0016
Further Details:      
 
Domain Number - Region: 82-96,253-282
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.0207
Family Nuclear receptor ligand-binding domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000096476   Gene: ENSMUSG00000028150   Transcript: ENSMUST00000098877
Sequence length 347
Comment pep:novel chromosome:GRCm38:3:94377516:94397648:1 gene:ENSMUSG00000028150 transcript:ENSMUST00000098877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSYLHCAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQCNVAYSCTRQQNCPI
DRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQQQQQEQVAKTP
PAGSRGADTLTYTLGLSDGQLPLGASPDLPEASACPPGLLRASGSGPPYSNTLAKTEVQG
ASCHLEYSPERGKAEGRDSIYSTDGQLTLGRCGLRFEETRHPELGEPEQGPDSHCIPSFC
SAPEVPYASLTDIEYLVQNVCKSFRETCQLRLEDLLRQRTNLFSREEVTSYQRKLPPKGK
LRSLCSQHVEKLQIFQHLHPIVVQAAFPPLYKELFSTDVESPEGLSK
Download sequence
Identical sequences ENSMUSP00000096476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]