SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000096921 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000096921
Domain Number 1 Region: 433-651
Classification Level Classification E-value
Superfamily TPR-like 3.38e-32
Family Tetratricopeptide repeat (TPR) 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000096921
Domain Number - Region: 184-255
Classification Level Classification E-value
Superfamily SIS domain 0.0523
Family mono-SIS domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000096921   Gene: ENSMUSG00000036676   Transcript: ENSMUST00000099318
Sequence length 658
Comment pep:known chromosome:GRCm38:10:100448178:100487347:-1 gene:ENSMUSG00000036676 transcript:ENSMUST00000099318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEGKMADINFKEVTLIVSVVAACYWNSLFCGFVFDDVSAILDNKDLHPSTPLKTLFQND
FWGTPMSEERSHKSYRPLTVLTFRLNYLLSELKPMSYHLLNTVFHAVVSVIFLKVCRLFL
DKRSSMIAALLFAVHPIHTEAVTGVVGRAELLSSVFFLAAFLSYTKSKGPDNSIVWTPIV
LTVFLVAVATLCKEQGITVVGICCVYEVFVAQGYTLPMLCTVAGQFLRGKGSIPLSMLQT
LVKLIVLMLSTLLLVVVRVQVIQSQLPVFTRFDNPAAVSPTPTRQLTFNYLLPVNAWLLL
NPSELCCDWTMGTIPLIESFLDVRNLATFAFFCFLGALGIFSLRYPGDSSKTVLMALCLM
ALPFIPASNLFFPVGFVVAERVLYVPSMGFCILVAHGWQKISNKSVLKKLSWVCLSMVIL
THALKTLHRNWDWESEYTLFMSALKVNKNNAKLWNNVGHALENEKNFEKALKYFLQATHV
QPDDIGAHMNVGRTYKNLNRTREAEASYMLAKSLMPQIIPGKKYAARIAPNHLNVYINLA
NLIRANESRLEEADQLYRQAISMRPDFKQAYISRGELLLKMNKPLKAKEAYLKALELDRN
NADLWYNLAIVYIELKEPNEALKNFNRALELNPKHKLALFNSAILMQESGKFPENVSI
Download sequence
Identical sequences A0A0R4J173
NP_001028504.1.92730 ENSMUSP00000096921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]