SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000096930 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000096930
Domain Number 1 Region: 624-688,845-1185
Classification Level Classification E-value
Superfamily Ras GEF 2.75e-118
Family Ras GEF 0.0000137
Further Details:      
 
Domain Number 2 Region: 224-447
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.79e-43
Family DBL homology domain (DH-domain) 0.00026
Further Details:      
 
Domain Number 3 Region: 23-132
Classification Level Classification E-value
Superfamily PH domain-like 2.26e-17
Family Pleckstrin-homology domain (PH domain) 0.009
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000096930
Domain Number - Region: 145-192
Classification Level Classification E-value
Superfamily N-terminal coiled coil domain from apc 0.0745
Family N-terminal coiled coil domain from apc 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000096930   Gene: ENSMUSG00000021708   Transcript: ENSMUST00000099326
Sequence length 1188
Comment pep:known chromosome:GRCm38:13:91884432:92131494:-1 gene:ENSMUSG00000021708 transcript:ENSMUST00000099326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKSVRYNEGHALYLAMLARKEGTKRGFLSKKAAEASRWHEKWFALYQNVLFYFEGEQSG
RPAGMYLLEGCSCERTPAPPRTNAGPAGARDALDKQYYFTVLFGHDGQKPLELRCEEEQA
GKEWMEAIHQASYADILIEREVLMQKYIHLVQIVETEKIATNQLRHQLEDQDTEIERLKS
EIVALNKTKERMRPYHVHQEEEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAES
MRKRNQIVFTMVEAETEYVHQLYILVNGFLRPLRMAASSKKPPINHDDVSSIFLNSETIM
FLHEIFHQGLKARLANWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFD
KLLKQYEANPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLE
ELSRVMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFIRQGKTGLSSSVDRTFSTAP
RRTGRSSQLEGQCQVMMISRQRLTITRHSGSCQHYLKLLLFPSIICCLNFEERHNNIETP
KQCDDMVSHDYHPVAEPVNGPVFTQILVKGSTQEKSSWKENILQCVDNIRCNGLMTIVFE
ENSKVTVPHMIKSDARLHKDDTDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSIDF
LNTFLHTYRIFTTATVVLAKLSDIYKRPFTSIPVRSLELFFATSQNNREHLVDGKSPRLC
RKFSSPPPLAVSRTSSPVRARKLSLTSSLNSRIGALDLTNSSSSSSPTTTTHSPAASPPP
HTAVLESAPADKAGDSADMSPCRSPTTPRHLRYRQPGGQVADSAHCSVSPASAFAIATAA
AGHGSPPGFNNERTCDKEFIIRRTATNRVLNVLRHWVSKHAQDFELNNELKMNVLNLLEE
VLRDPDLLPQERKATANILRALSQDDQDDIHLKLEDIIQMTDCPKAECFETLSAMELAEQ
ITLLDHIVFRSIPYEEFLGQGWMKLDKNERTPYIMKTSQHFNEMSNLVASQIMNYADISS
RANAIEKWVAVADICRCLHNYNGVLEITSALNRSAIYRLKKTWAKVSKQTKALMDKLQKT
VSSEGRFKNLRETLKNCNPPAVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHII
REIRQFQQTAYRIDQQPKVIQYLLDKALVIDEDSLYELSLKIEPRLPA
Download sequence
Identical sequences D3Z6K8
ENSMUSP00000096930 ENSMUSP00000096930 ENSMUSP00000116892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]