SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000097083 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000097083
Domain Number 1 Region: 3-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-23
Family KRAB domain (Kruppel-associated box) 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000097083   Gene: ENSMUSG00000066613   Transcript: ENSMUST00000099484
Sequence length 65
Comment pep:putative chromosome:GRCm38:5:109996522:110007467:1 gene:ENSMUSG00000066613 transcript:ENSMUST00000099484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDALTYDDVYVNFTQEEWALLNPSQKSLYKDVMLETYRNLNAVGYNWEDSNIEEHCESS
RRHGR
Download sequence
Identical sequences Q8BJ78
ENSMUSP00000097083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]