SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000097177 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000097177
Domain Number 1 Region: 9-111
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.14e-30
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00032
Further Details:      
 
Domain Number 2 Region: 121-218
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 4.32e-28
Family Anticodon-binding domain of PheRS 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000097177   Gene: ENSMUSG00000021420   Transcript: ENSMUST00000099582
Sequence length 219
Comment pep:known chromosome:GRCm38:13:36117411:36537592:1 gene:ENSMUSG00000021420 transcript:ENSMUST00000099582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAVKLVEFDLKQVLTRLVTHLFGDGLEVRWVDCYFPFTHPSFEMEINFRGEWLEVLGCG
VMEQQLVNSAGAQDRIGWAFGLGLERLAMVLYDIPDIRLFWSEDERFLKQFLLSDINQSV
KFQPLSKYPAVFNDISFWLPSENYTENDFYDIVRTVGGDLVEKVDLIDKFEHPKTHRTSH
CYRITYRHMERTLSQREVGNVHQAVQEAAVQLLGVEGRF
Download sequence
Identical sequences G3X9Q4
NP_001034278.1.92730 XP_006516835.1.92730 ENSMUSP00000097177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]