SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000097519 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000097519
Domain Number 1 Region: 315-539
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.41e-34
Family Calponin-homology domain, CH-domain 0.00038
Further Details:      
 
Domain Number 2 Region: 636-667
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000143
Family LIM domain 0.00074
Further Details:      
 
Domain Number 3 Region: 603-635
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000146
Family LIM domain 0.0022
Further Details:      
 
Domain Number 4 Region: 81-163,304-359
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000928
Family FAD/NAD-linked reductases, N-terminal and central domains 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000097519   Gene: ENSMUSG00000019823   Transcript: ENSMUST00000099934
Sequence length 975
Comment pep:novel chromosome:GRCm38:10:41476368:41487032:1 gene:ENSMUSG00000019823 transcript:ENSMUST00000099934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPASTNPAHDHFETFVQAQLCQDVLSSFQGLCRALGVESGGGLSQYHKIKAQLNYWSA
KSLWAKLDKRASQPVYQQGQACTNTKLQLLLLKVALLLGVEIHWGVKFTGLQPPPRKGSG
WRAQLQPNPPAQLASYEFDVLISAAGGKFVPEGFTIREMRGKLAIGITANFVNGRTVEET
QVPEISGVARIYNQKFFQSLLKATGIDLENIVYYKDETHYFVMTAKKQCLLRLGVLRQDL
SETDQLLGKANVVPEALQRFARAAADFATHGKLGKLEFAQDARGRPDVAAFDFTSMMRAE
SSARVQEKHGARLLLGLVGDCLVEPFWPLGTGVARGFLAAFDAAWMVKRWAEGAGPLEVL
AERESLYQLLSQTSPENMHRNVAQYGLDPATRYPNLNLRAVTPNQVQDLYDMMDKEHAQR
KSDEPDSRKTTTGSAGTEELLHWCQEQTAGFPGVHVTDFSSSWADGLALCALVHHLQPGL
LEPSELQGMGALEATTWALRVAEHELGITPVLSAQAVMAGSDPLGLIAYLSHFHSAFKNT
SHSSGLVSQPSGTPSAILFLGKLQRSLQRTRAKVDEETPSTEEPPVSEPSMSPNTPELSE
HQEAGAEELCELCGKHLYILERFCVDGHFFHRSCFCCHTCEATLWPGGYGQHPGDGHFYC
LQHLPQEDQKEADNNGSLESQELPTPGDSNMQPDPSSPPVTRVSPVPSPSQPARRLIRLS
SLERLRLSSLNIIPDSGAEPPPKPPRSCSDLARESLKSSFVGWGVPVQAPQVPEAIEKGD
DEEEEEEEEEEEEEPLPPLEPELEQTLLTLAKNPGAMTKYPTWRRTLMRRAKEEEMKRFC
KAQAIQRRLNEIEATMRELEAEGTKLELALRKESSSPEQQKKLWLDQLLRLIQKKNSLVT
EEAELMITVQELDLEEKQRQLDHELRGYMNREETMKTEADLQSENQVLRKLLEVVNQRDA
LIQFQEERRLREMPA
Download sequence
Identical sequences NP_001157905.1.92730 ENSMUSP00000097519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]