SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000097572 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000097572
Domain Number 1 Region: 608-913
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.29e-115
Family PDEase 0.0000000716
Further Details:      
 
Domain Number 2 Region: 199-398
Classification Level Classification E-value
Superfamily GAF domain-like 3.27e-47
Family GAF domain 0.0000991
Further Details:      
 
Domain Number 3 Region: 382-584
Classification Level Classification E-value
Superfamily GAF domain-like 2.4e-42
Family GAF domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000097572   Gene: ENSMUSG00000075270   Transcript: ENSMUST00000099992
Sequence length 933
Comment pep:known chromosome:GRCm38:2:75989912:76338774:-1 gene:ENSMUSG00000075270 transcript:ENSMUST00000099992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASRLDFGEVETFLDRHPELFEDYLMRKGKQELVDKWLQRHTSGQGASSLRPALAGASS
LAQSNAKGSPGIGGGAGPQGSAHSHPTPGGGESAGVPLSPSWASGSRGDGSLQRRASQKE
LRKSFARSKAIHVNRTYDEQVTSRAQEPLSSVRRRALLRKASSLPPTTAHILSALLESRV
NLPQYPPTAIDYKCHLKKHNERQFFLELVKDISNDLDLTSLSYKILIFVCLMVDADRCSL
FLVEGAAAGKKTLVSKFFDVHAGTPLLPCSSTENSNEVQVPWGKGIIGYVGEHGETVNIP
DAYQDRRFNDEIDKLTGYKTKSLLCMPIRNSDGEIIGVAQAINKVPEGAPFTEDDEKVMQ
MYLPFCGIAISNAQLFAASRKEYERSRALLEVVNDLFEEQTDLEKIVKKIMHRAQTLLKC
ERCSVLLLEDIESPVVKFTKSFELMSPKCSADAENSFKESVEKSSYSDWLINNSIAELVA
STGLPVNVSDAYQDPRFDAEADQISGFHIRSVLCVPIWNSNHQIIGVAQVLNRLDGKPFD
DADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDVLSYHATCSKAEVDKFKAANI
PLVSELAIDDIHFDDFSLDVDAMITAALRMFMELGMVQKFKIDYETLCRWLLTVRKNYRM
VLYHNWRHAFNVCQLMFAMLTTAGFQEILTEVEILAVIVGCLCHDLDHRGTNNAFQAKSD
SALAQLYGTSATLEHHHFNHAVMILQSEGHNIFANLSSKEYSDLMQLLKQSILATDLTLY
FERRTEFFELVRKGDYDWSITSHRDVFRSMLMTACDLGAVTKPWEISRQVAELVTSEFFE
QGDRERSELKLTPSAIFDRNRKDELPRLQLEWIDSICMPLYQALVKVNAKLKPMLDSVAA
NRRKWEELHQKRLQVSAASPDPASPMVAGEDRL
Download sequence
Identical sequences P0C1Q2
10090.ENSMUSP00000097572 ENSMUSP00000097572 ENSMUSP00000115662 ENSMUSP00000097572 NP_001074502.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]