SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000097628 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000097628
Domain Number 1 Region: 395-656
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-46
Family YWTD domain 0.000005
Further Details:      
 
Domain Number 2 Region: 709-968
Classification Level Classification E-value
Superfamily YWTD domain 5.1e-46
Family YWTD domain 0.0000181
Further Details:      
 
Domain Number 3 Region: 265-280,315-384,649-705
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.2e-16
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 4 Region: 101-143
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000694
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 1106-1144
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000877
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 6 Region: 1266-1307
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000995
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 7 Region: 1148-1185
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000196
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 8 Region: 26-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000038
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 9 Region: 1021-1059
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000942
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 10 Region: 1065-1102
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 11 Region: 1227-1265
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000072
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 12 Region: 181-218
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000109
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 13 Region: 1186-1224
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 14 Region: 221-259
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 15 Region: 65-101
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000511
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 16 Region: 1311-1347
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000262
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 17 Region: 146-180
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000746
Family LDL receptor-like module 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000097628
Domain Number - Region: 973-1021
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000275
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000097628   Gene: ENSMUSG00000027070   Transcript: ENSMUST00000100051
Sequence length 1363
Comment pep:known chromosome:GRCm38:2:69506204:69586029:-1 gene:ENSMUSG00000027070 transcript:ENSMUST00000100051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERGAAAAAWMLLLAIAACLAPVSGQECGSGNFRCDNGYCIPASWRCDGTRDCLDDTDEI
GCPPRSCGSGFFLCPAEGTCIPSSWVCDQDKDCSDGADEQQNCPGTTCSSQQLTCSNGQC
VPIEYRCDHVSDCPDGSDERNCYYPTCDQLTCANGACYNTSQKCDHKVDCRDSSDEANCT
TLCSQKEFQCGSGECILRAYVCDHDNDCEDNSDEHNCNYDTCGGHQFTCSNGQCINQNWV
CDGDDDCQDSGDEDGCESNQRHHTCYPREWACPGSGRCISMDKVCDGVPDCPEGEDENNA
TSGRYCGTGLCSILNCEYQCHQTPYGGECFCPPGHIINSNDSRTCIDFDDCQIWGICDQK
CESRQGRHQCLCEEGYILERGQHCKSNDSFSAASIIFSNGRDLLVGDLHGRNFRILAESK
NRGIVMGVDFHYQKHRVFWTDPMQAKVFSTDINGLNTQEILNVSIDAPENLAVDWINNKL
YLVETRVNRIDVVNLEGNQRVTLITENLGHPRGIALDPTVGYLFFSDWGSLSGQPKVERA
FMDGSNRKDLVTTKLGWPAGITLDLVSKRVYWVDSRYDYIETVTYDGIQRKTVARGGSLV
PHPFGISLFEEHVFFTDWTKMAVMKANKFTDTNPQVYHQSSLTPFGVTVYHALRQPNATN
PCGNNNGGCAQICVLSHRTDNGGLGYRCKCEFGFELDADEHHCVAVKNFLLFSSQTAVRG
IPFTLSTQEDVMVPVTGSPSFFVGIDFDAQHSTIFYSDLSKNIIYQQKIDGTGKEVITAN
RLQNVECLSFDWISRNLYWTDGGSKSVTVMKLADKSRRQIISNLNNPRSIVVHPAAGYMF
LSDWFRPAKIMRAWSDGSHLMPIVNTSLGWPNGLAIDWSTSRLYWVDAFFDKIEHSNLDG
LDRKRLGHVDQMTHPFGLTVFKDNVFLTDWRLGAIIRVRKSDGGDMTVVRRGISSIMHVK
AYDADLQTGTNYCSQTTHPNGDCSHFCFPVPNFQRVCGCPYGMKLQRDQMTCEGDPAREP
PTQQCGSSSFPCNNGKCVPSIFRCDGVDDCHDNSDEHQCGALNNTCSSSAFTCVHGGQCI
PGQWRCDKQNDCLDGSDEQNCPTRSPSSTCPPTSFTCDNHMCIPKEWVCDTDNDCSDGSD
EKNCQASGTCHPTQFRCPDHRCISPLYVCDGDKDCVDGSDEAGCVLNCTSSQFKCADGSS
CINSRYRCDGVYDCKDNSDEAGCPTRPPGMCHPDEFQCQGDGTCIPNTWECDGHPDCIQG
SDEHNGCVPKTCSPSHFLCDNGNCIYNSWVCDGDNDCRDMSDEKDCPTQPFHCPSSQWQC
PGYSICVNLSALCDGVFDCPNGTDESPLCSKFPDHSLLDTNLF
Download sequence
Identical sequences A2ARV5
ENSMUSP00000097628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]