SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000097820 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000097820
Domain Number 1 Region: 137-406
Classification Level Classification E-value
Superfamily EndoU-like 3.53e-95
Family Eukaryotic EndoU ribonuclease 0.0000087
Further Details:      
 
Domain Number 2 Region: 21-61
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000000693
Family Somatomedin B domain 0.0012
Further Details:      
 
Domain Number 3 Region: 87-127
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000000418
Family Somatomedin B domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000097820   Gene: ENSMUSG00000022468   Transcript: ENSMUST00000100249
Sequence length 412
Comment pep:known chromosome:GRCm38:15:97711019:97731405:-1 gene:ENSMUSG00000022468 transcript:ENSMUST00000100249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKARVPFIVAMLCGLAWAGNLESCASRCHEKFNRDAVCQCDRRCPQHDDCCDDYEHLCTA
EEGPPEPEAFLDPEDKIPTSHLYSAPSSCQGRCREAYDKHHPCHCNDRCPEFGNCCEDFD
SLCGGDHEGFSHSSDAVTKEELESISETIYRVDTNKAQKEDIVLNSQNRISPSETGNQVD
RSPEPLFTYVNEKLFSKPTYAAFINLLNNYQRATGHGEHFSAQQLEEQGVFLREVMKTAV
MKELYSFLHHQNRYSSEQEFVDDLKNMWFGLYSRGNDEGDSSGFEHVFSGEVKKGKVTGF
HNWIRFYLQEKEGLLDYYSHNYDGPWDSYPDVLAMQFNWDGYYKEVGSVFIGSSPEFEFA
LYSLCFITRPGKKCHLSLGGYPLAIQTYTWDKTTYGNGKKYIATAYVVSSSQ
Download sequence
Identical sequences Q3V188
ENSMUSP00000097820 NP_001162164.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]