SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000098098 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000098098
Domain Number 1 Region: 1013-1207
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.85e-27
Family Reverse transcriptase 0.0022
Further Details:      
 
Domain Number 2 Region: 1551-1645
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000000000455
Family Retroviral integrase, catalytic domain 0.024
Further Details:      
 
Domain Number 3 Region: 1253-1393
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000209
Family Ribonuclease H 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000098098   Gene: ENSMUSG00000075592   Transcript: ENSMUST00000100529
Sequence length 1840
Comment pep:known chromosome:GRCm38:14:55854036:55874291:1 gene:ENSMUSG00000075592 transcript:ENSMUST00000100529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLSGGKPPAQEWFMVQTKSKPRVHRQRLQVQRIFRVKVTAFQSRPDTPYFWLQLEGPRE
NTGKAKEYLKGLCNPELWKEVRYPPVLHCAFLGAQGLFLDCLCWSTLAYLVPGPPGSLMV
GGLTESFTMTQNWLEELVARLRWGPAPMITPRGVWETEVTRAFGALVWIRCDKYAGDLLQ
LPPAVQELLLSLVRDAAGKEDIIEWLGHFGISGTCPNPEILICLARQQKESASLVTIKES
PGTLQEIGALNRASENSKKTTSSGAAGSLTQAQSPPAQETADQLARDQSNKQGDETNSVG
EEGTATQDTSSQDSENPTQALLQQKQVPKNEERISLLLPVSALSAYTSWKVWAPGTAFGP
SWPGTIAATFWKINELQSLHLAWLLSQACLNFPFWQRPTGPIQLKLPGRNPLPLKLEWKQ
KELVPLSSAGSPACRPGGDLGRETALKHSPRPEIPSKIISLSVVPGGCGIKEKVSPGLLQ
VGQSSTSVGDKGISLSDCKGLEKPFSLALSTEQGGSTAQERPLAQVPEAPTVSETLQVAT
AAEVSNVEHPPTGEGLPATPKVPTALKKPAVYTEPTAPKVPSAPTEPAAPATPTAPQTPT
AQKTPSVKTLAGLQTPKVQSETIATAGSEVPKAPAASAVAGPTVDVAQLLSEVQASKNRA
IMLKVQGKPGRQGFQPSSTVPSRSKHQFLKEGLLGAWEGSQRLSPHSQGTNIVTSFQRYN
EALNTPFEMNLSEEPGNPGLRRVVIDGSSVAMVHGLQHFFSCRGIAMAVQYFWNRGHREI
TVFVPTWQLKKNRRVRESHFLTKLHRLKMLSITPSQLENGKKITTYDYRFMVKLAEETDG
VIVTNEQIHILMNNSKKLMVKDRLLPFTFAGSLFMVPDDPLGRDGPTLEEFLKKPNRLDM
DIGNFLKVWKTLPPSSASISELSDDADAEPLEDPQDVEEAGKEEGSLEEEPGIPKPDEED
EQDTNPVSVFGVECPSFSEEILQCLSLHDPSEGTLDIDLLPVVSSPYLDVPWDGKAPCQQ
VLAQLAQLNIPSNFTALSFFMGFMDSHRDVISDYEDLVGPLHGLLKQKPDWQWNQEHEKS
FLALKRALVCALCLSTPNPNLPFYLEVTVSQVSLTASLHQEHSGRKHPIAYTSKPLLPDE
DSEGPQSGGDSPYAVAWALKHFARCVGDNPVVLRLSYASRTTVDNEAWDSRRASKAWLIR
WSLLLQDKGKRELELSLLQGLLGENQLLTPPSSMPRVFQPLPPSSDLSTFICVHVSGYCF
YRDDELCAGFGLYILSPTSPPVSLAFSCSPYTTTYAHLAAVACGLERFGQSQHPVVFLTH
CNWIFSVLWELLPLWRVRGFLSSDGASLPHPSLLSYIISLTSGFSPLPFIYRTSYRGSLF
AVTVDTLAKQGAQGGGQWWDLPKDVPVPMVTPHPKGRKPNLLALQLSDTTLADIIAKLQA
GQKLSGPSPFSSAFNSLSLDQDSGLLMFKGERHPRVWVVPRQLRRDLIFSVHDSPIGEHQ
GLEDTYKTVRLLGWWPGMQDHVRDYCRSCLFCIPRNLIGGELKVIESPWPLRSTAPWSSL
QIEVVGPVTVSEEGHKHVLIVADANTRWVEAFPLKPYTHVAVAQVLLQHVFARWGVPIRL
EAAQGPQFARHVLVSCGLALGAQVTTLSRALQFPCLMSSEAYWEFKRALKEFIFLYGKKW
AASLPLLHLAFRASTTEATPFQVLTGGEMKLMEPVWWEMSRANIEGLKMDAFLLQLMREL
LDLHWRVAEKASEKAENRRFKRESQENEWSVGDQVLLLSLPRNGSSAKWMGPFYIGDRLS
LSLYRVWGFPVPDKLGCVYPSSLMKAFPKHDTPLSLDVEQ
Download sequence
Identical sequences Q5DTZ0
ENSMUSP00000098098 ENSMUSP00000098098 NP_001035161.1.92730 ENSMUSP00000098098 ENSMUSP00000129557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]