SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000098205 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000098205
Domain Number 1 Region: 122-296,351-462
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.35e-43
Family FAD-linked reductases, N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000098205   Gene: ENSMUSG00000022351   Transcript: ENSMUST00000100640
Sequence length 540
Comment pep:novel chromosome:GRCm38:15:59315107:59331192:1 gene:ENSMUSG00000022351 transcript:ENSMUST00000100640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTFLGIATFTYFYKKCGDVTLANKELLLCVLVFLSLGLVLSYRCRHRHGGLLGRHQSGA
QFAAFSDILSALPLIGFFWAKSPESEKKEQLESKKCRKEIGLSETTLTGAATSVSTSFVT
DPEVIIVGSGVLGSALAAVLSRDGRKVTVIERDLKEPDRIVGELLQPGGYRVLQELGLGD
TVEGLNAHHIHGYIVHDYESRSEVQIPYPLSETNQVQSGIAFHHGRFIMSLRKAAMAEPN
VKFIEGVVLQLLEEDDAVIGVQYKDKETGDTKELHAPLTVVADGLFSKFRKSLISSKVSV
SSHFVGFLMKDAPQFKPNFAELVLVNPSPVLIYQISSSETRVLVDIRGELPRNLREYMAE
QIYPQLPGVLILGDAYNLRHPLTGGGMTVALKDIKLWRQLLKDIPDLYDDAAIFQAKKSF
FWSRKRTHSFVVNVLAQALYELFSATDDSLHQLRKACFLYFKLGGECVTGPVGLLSILSP
HPLVLIRHFFSVAIYATYFCFKSEPWATKPRALFSSGAVLYKACSILFPLIYSEMKYLVH
Download sequence
Identical sequences Q3TSS7
ENSMUSP00000098205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]