SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000098320 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000098320
Domain Number 1 Region: 230-429
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.8e-57
Family Reprolysin-like 0.0000383
Further Details:      
 
Domain Number 2 Region: 448-520
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 4.28e-19
Family Blood coagulation inhibitor (disintegrin) 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000098320   Gene: ENSMUSG00000072647   Transcript: ENSMUST00000100757
Sequence length 791
Comment pep:known chromosome:GRCm38:5:121518576:121521695:-1 gene:ENSMUSG00000072647 transcript:ENSMUST00000100757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVAAAGRGFASSLSSPQIRRIALKEAKLTPHIWAALHWNLGLRLVPSVRVGILVLLIFL
PSTFCDIGSVYNSSYETVIPERLPGKGGKDPGGKVSYMLLMQGQKQLLHLEVKGHYPENN
FPVYSYHNGILRQEMPLLSQDCHYEGYMEGVPGSFVSVNICSGLRGVLIKEETSYGIEPM
LSSKNFEHVLYTMEHQPVVSCSVTPKDSPGDTSHPPRSRKPDDLLVLTDWWSHTKYVEMF
VVVNHQRFQMWGSNINETVQAVMDIIALANSFTRGINTEVVLVGLEIWTEGDPIEVPVDL
QTTLRNFNFWRQEKLVGRVRHDVAHLIVGHRPGENEGQAFLRGACSGEFAAAVEAFHHED
VLLFAALMAHELGHNLGIQHDHPTCTCGPKHFCLMGEKIGKDSGFSNCSSDHFLRFLHDH
RGACLLDEPGRQSRMRRAANCGNGVVEDLEECDCGSDCDSHPCCSPTCTLKEGAQCSEGL
CCYNCTFKKKGSLCRPAEDVCDLPEYCDGSTQECPANSYMQDGTQCDRIYYCLGGWCKNP
DKQCSRIYGYPARSAPEECYISVNTKANRFGNCGHPTSANFRYETCSDEDVFCGKLVCTD
VRYLPKVKPLHSLLQVPYGEDWCWSMDAYNITDVPDDGDVQSGTFCAPNKVCMEYICTGR
GVLQYNCEPQEMCHGNGVCNNFKHCHCDAGFAPPDCSSPGNGGSVDSGPVGKPADRHLSL
SFLAEESPDDKMEDEEVNLKVMVLVVPIFLVVLLCCLMLIAYLWSEVQEVVSPPSSSESS
SSSSWSDSDSQ
Download sequence
Identical sequences Q3V0H1 Q60813
10090.ENSMUSP00000098320 ENSMUSP00000098320 NP_742124.2.92730 ENSMUSP00000098320 ENSMUSP00000098320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]