SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000098808 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000098808
Domain Number 1 Region: 22-199
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.48e-41
Family GABA-aminotransferase-like 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000098808   Gene: ENSMUSG00000020359   Transcript: ENSMUST00000101250
Sequence length 231
Comment pep:known chromosome:GRCm38:11:51584757:51603254:1 gene:ENSMUSG00000020359 transcript:ENSMUST00000101250 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAADTRAKAVTLDLRRRLLSSSCRLFFPEDPVKIIRGQGQYLYDEQGREYLDCINNVAHV
GHCHPTVVQAAHEQNLVLNTNSRYLHDNIVDYAQRLSETLPEQLSVFYFLNSGSEANDLA
LRLARQYTGHQDVVVLDHAYHGHLSSLIDISPYKFRNLGGQKEWVHVAPLPDTYRGPYRE
DHPNPAEAYANEVKHVISSAQQKGRKTVLKNQFPKMTIVEHAFNPALGRQT
Download sequence
Identical sequences F8WHK6
ENSMUSP00000098808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]