SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000098936 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000098936
Domain Number 1 Region: 4-142
Classification Level Classification E-value
Superfamily Globin-like 4.36e-43
Family Globins 0.00000533
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000098936   Gene: ENSMUSG00000073063   Transcript: ENSMUST00000101387
Sequence length 142
Comment pep:known chromosome:GRCm38:11:32286965:32287727:1 gene:ENSMUSG00000073063 transcript:ENSMUST00000101387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARSQDDQWLVLALWKKMGSNVGIYATEALERTFVAFPSTKTYFPHLDLRPGSSQVKAHA
QKVADALTLATQHLDDLPASLSALSDLHAHKLCVDPANFQFFSHCLLVTLARHYPGDFSP
EMHASLDKFLGHVTSALVSKYR
Download sequence
Identical sequences Q3U0A6
NP_001029153.1.92730 ENSMUSP00000098936 ENSMUSP00000098936 10090.ENSMUSP00000098936 ENSMUSP00000098936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]