SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000099411 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000099411
Domain Number 1 Region: 146-462
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.8e-126
Family Transglutaminase core 0.0000000000243
Further Details:      
 
Domain Number 2 Region: 3-144
Classification Level Classification E-value
Superfamily E set domains 2.55e-41
Family Transglutaminase N-terminal domain 0.00000143
Further Details:      
 
Domain Number 3 Region: 472-584
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.94e-32
Family Transglutaminase, two C-terminal domains 0.00000385
Further Details:      
 
Domain Number 4 Region: 585-685
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 5.49e-28
Family Transglutaminase, two C-terminal domains 0.00000894
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000099411   Gene: ENSMUSG00000037820   Transcript: ENSMUST00000103122
Sequence length 686
Comment pep:known chromosome:GRCm38:2:158116402:158146436:-1 gene:ENSMUSG00000037820 transcript:ENSMUST00000103122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEELLLERCDLEIQANGRDHHTADLCQEKLVLRRGQRFRLTLYFEGRGYEASVDSLTFG
AVTGPDPSEEAGTKARFSLSDNVEEGSWSASVLDQQDNVLSLQLCTPANAPIGLYRLSLE
ASTGYQGSSFVLGHFILLYNAWCPADDVYLDSEEERREYVLTQQGFIYQGSVKFIKSVPW
NFGQFEDGILDTCLMLLDMNPKFLKNRSRDCSRRSSPIYVGRVVSAMVNCNDDQGVLLGR
WDNNYGDGISPMAWIGSVDILRRWKEHGCQQVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEFGELESNKSEMIWNFHCWVESWMTRPDLQPGYEGWQAIDPT
PQEKSEGTYCCGPVSVRAIKEGDLSTKYDAPFVFAEVNADVVDWIRQEDGSVLKSINRSL
VVGQKISTKSVGRDDREDITHTYKYPEGSPEEREVFTKANHLNKLAEKEETGVAMRIRVG
DSMSMGNDFDVFAHIGNDTSETRECRLLLCARTVSYNGVLGPECGTEDINLTLDPYSENS
IPLRILYEKYSGCLTESNLIKVRGLLIEPAANSYLLAERDLYLENPEIKIRVLGEPKQNR
KLVAEVSLKNPLSDPLYDCIFTVEGAGLTKEQKSVEVSDPVPAGDLVKARVDLFPTDIGL
HKLVVNFQCDKLKSVKGYRNVIIGPA
Download sequence
Identical sequences P21981
ENSMUSP00000099411 ENSMUSP00000099411 ENSMUSP00000099411 NP_033399.1.92730 10090.ENSMUSP00000099411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]