SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000099498 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000099498
Domain Number 1 Region: 122-286
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.74e-44
Family Matrix metalloproteases, catalytic domain 0.0000571
Further Details:      
 
Domain Number 2 Region: 321-488
Classification Level Classification E-value
Superfamily Hemopexin-like domain 6.54e-42
Family Hemopexin-like domain 0.00053
Further Details:      
 
Domain Number 3 Region: 32-95
Classification Level Classification E-value
Superfamily PGBD-like 0.00000000000000173
Family MMP N-terminal domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000099498   Gene: ENSMUSG00000020682   Transcript: ENSMUST00000103209
Sequence length 496
Comment pep:known chromosome:GRCm38:11:83440768:83463022:-1 gene:ENSMUSG00000020682 transcript:ENSMUST00000103209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAGVSLLLRALPLLLWGCQDAQPTQHGLPELRQEAEAFLEKYGYLSEQGSKAPASAQFR
NAIREFQWISQLPLSGVLDQATLRQMTRPRCGVADTDSHATWTERISTLLAGHRAKMRRK
KRFAKPGNKWYKQHLSYRLVNWPERLPEPAVRGAVRAAFQLWSNVSALEFWEAPATGPAD
IRLTFFQGDHNDGLANAFDGPGGALAHAFLPRRGEAHFDGDERWSLSRRRGRNLFVVLAH
EIGHTLGLTHSPAPRALMAPYYKKLGRDALLSWDDVLAVQSLYGKPLGRSVATQLPGKVF
TDFEAWDPHNSQSRRPETRGPKYCHSSFDAITVEPRPLQKRWPGLPPGIEAAAVSLEDGD
FYFFKGNRCWRFQGTKSVWGFAQLCRAGGLPRHPDAALFFPPLRRLVLFKGSRYYVLAQG
GMQVEPYYPRSLRDWAGVPEEVSGALPRPDGSIIFFRDDHYWHLDQAKLRVTSSGRWATE
LSWMGCWNANSGGALF
Download sequence
Identical sequences Q8BG29
NP_766385.1.92730 ENSMUSP00000099498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]