SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000099511 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000099511
Domain Number 1 Region: 36-162
Classification Level Classification E-value
Superfamily Lysozyme-like 1.96e-46
Family C-type lysozyme 0.0000275
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000099511   Gene: ENSMUSG00000053184   Transcript: ENSMUST00000103222
Sequence length 163
Comment pep:known chromosome:GRCm38:11:80858372:80867814:1 gene:ENSMUSG00000053184 transcript:ENSMUST00000103222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEARSRAPRRQLCPPGITWLALAYLLSCLLASSKAKVFSRCELAKEMHDFGLDGYRGYNL
ADWVCLAYYTSGFNTNAVDHEADGSTNNGIFQISSRRWCRTLASNGPNLCRIYCTDLLNN
DLKDSIVCAMKIVQEPLGLGYWEAWRHHCQGRDLSDWVDGCDF
Download sequence
Identical sequences A0A077S9M6
ENSMUSP00000099511 ENSMUSP00000099512 NP_083643.1.92730 XP_011247596.1.92730 ENSMUSP00000099511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]