SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000099759 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000099759
Domain Number 1 Region: 439-635,736-992
Classification Level Classification E-value
Superfamily Ras GEF 7.19e-115
Family Ras GEF 0.00017
Further Details:      
 
Domain Number 2 Region: 182-320
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.29e-43
Family DEP domain 0.000000124
Further Details:      
 
Domain Number 3 Region: 643-745
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.51e-36
Family Ras-binding domain, RBD 0.0011
Further Details:      
 
Domain Number 4 Region: 21-157
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.98e-26
Family cAMP-binding domain 0.000000157
Further Details:      
 
Domain Number 5 Region: 313-442
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.14e-25
Family cAMP-binding domain 0.000000842
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000099759   Gene: ENSMUSG00000049044   Transcript: ENSMUST00000102698
Sequence length 993
Comment pep:known chromosome:GRCm38:2:71981287:72256376:1 gene:ENSMUSG00000049044 transcript:ENSMUST00000102698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAAHAAHSQSSAEWIACLDKRPLERSSEDVDIIFTRLKGVKAFEKFHPNLLRQICLCGY
YENLEKGITLFRQGDIGTNWYAVLAGSLDVKVSETSSHQDAVTICTLGIGTAFGESILDN
TPRHATIVTRESSELLRIEQEDFKALWEKYRQYMAGLLAPPYGVMETGSNNDRIPDKENV
PSEKILRAGKILRIAILSRAPHMIRDRKYHLKTYRQCCVGTELVDWMIQQTSCVHSRTQA
VGMWQVLLEDGVLNHVDQERHFQDKYLFYRFLDDEREDAPLPTEEEKKECDEELQDTMLL
LSQMGPDAHMRMILRKPPGQRTVDDLEIIYDELLHIKALSHLSTTVKRELAGVLIFESHA
KGGTVLFNQGEEGTSWYIILKGSVNVVIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVL
REDNCHFLRVDKEDFNRILRDVEANTVRLKEHDQDVLVLEKVPAGNRAANQGNSQPQQKY
TVMSGTPEKILEHFLETIRLEPSLNEATDSVLNDFVMMHCVFMPNTQLCPALVAHYHAQP
SQGTEQERMDYALNNKRRVIRLVLQWAAMYGDLLQEDDVAMAFLEEFYVSVSDDARMMAA
FKEQLPELEKIVKQISEDAKAPQKKHKVLLQQFNTGDERAQKRQPIRGSDEVLFKVYCID
HTYTTIRVPVAASVKEVISAVADKLGSGEGLIIVKMNSGGEKVVLKSNDVSVFTTLTING
RLFACPREQFDSLTPLPEQEGPTTGTVGTFELMSSKDLAYQMTTYDWELFNCVHELELIY
HTFGRHNFKKTTANLDLFLRRFNEIQFWVVTEVCLCSQLSKRVQLLKKFIKIAAHCKEYK
NLNSFFAIVMGLSNVAVSRLALTWEKLPSKFKKFYAEFESLMDPSRNHRAYRLTAAKLEP
PLIPFMPLLIKDMTFTHEGNKTFIDNLVNFEKMRMIANTARTVRYYRSQPFNPDAAQANK
NHQDVRSYVRQLNVIDNQRTLSQMSHRLEPRRP
Download sequence
Identical sequences ENSMUSP00000099759 NP_062662.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]