SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000099804 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000099804
Domain Number 1 Region: 380-546,842-1060,1106-1146
Classification Level Classification E-value
Superfamily Ras GEF 2.48e-107
Family Ras GEF 0.00011
Further Details:      
 
Domain Number 2 Region: 527-614
Classification Level Classification E-value
Superfamily PDZ domain-like 5.19e-19
Family PDZ domain 0.006
Further Details:      
 
Domain Number 3 Region: 258-382
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.01e-18
Family cAMP-binding domain 0.001
Further Details:      
 
Domain Number 4 Region: 17-118
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000000511
Family cAMP-binding domain 0.0057
Further Details:      
 
Domain Number 5 Region: 752-831
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000182
Family Ras-binding domain, RBD 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000099804   Gene: ENSMUSG00000037533   Transcript: ENSMUST00000102743
Sequence length 1601
Comment pep:known chromosome:GRCm38:11:54522847:54699285:1 gene:ENSMUSG00000037533 transcript:ENSMUST00000102743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSPVDPGARQALRKKPPERTPEDLNIIYSYLHGMEILSNLREHQLRLMSTRARYERYSG
NQMLFCSETIARCWYILLSGSVLVKDSMVLPPCSFGKQFGGKRGCDCLVLEPSEMIVVEN
SKDNEDSILQREIPARQSRRRFRKINYKGERQTIIDGVDINNYLSLPADLTKMHLTDNPH
PQVTHVSSSQSGCSIASDSGSSSLSDIYQATESEVGDVDLTRLPEGPVDSEDEEEEEEEI
DRTDPLQGRDLVRECLEKEPADKTDDDVEQLLEFMHQLPAFANMTMSVRRELCSVMVFEV
VEQAGAVILEDGQELDSWYVILNGTVEISHPDGKIENLFMGNSFGIVPTLDKQHMHGAVR
TKVDDCQFVCIAQQDYWRILNHVEKNTHKVEEEGEIVMVHEHRELDRSGTRKGHIVIKAT
PERLIMHLIEEHSIVDPTYIEDFLLTYRTFLETPLDVGIKLLEWFKIDNLRDKVTRIVLL
WVNNHFNDFEGDPAMTQFLEEFERNLEDTKMNGHLRLLNIACAAKAKWRQVVLQKASRES
PLHFCLTGGSEKGFGVFVEEVESGSKAADAGLKRGDQVMEVNGQNFENITLAKALEILRN
NTHLALTVKTNIFVFKELLSRTEQEKSGVPHIPKIAEKKSNRHSIQDVPGDMEQAPQEKG
NKKIKANTVSGGRNKIRKILDKTRFSILPPKLFSDGGLSQSQDDSIVGTRHCRHSLAIMP
IPGTLSSSSPDLLQPTTSMLDFSNPSDIPDQVIRVFKADQQSCYIIISKDTTAKEVVCQA
VQEFGLTGASDTYSLCEVSVTPEGVIKQRRLPDQFSKLADRIQLNGRYYLKNNMETETLC
SDEDAQELLKESQLSMLQLSTIEVATQLSMRDFDLFRNIEPTEYIDDLFKLDSKTGNTHL
KQFEDIVNQETFWVASEILSESNQLKRMKIIKHFIKIALHCRECKNFNSMFAIISGLNLA
PVARLRGTWEKLPSKYEKHLQDLQDLFDPSRNMAKYRNILSSQSMQPPIIPLFPVVKKDM
TFLHEGNDSKVDGLVNFEKLRMIAKEIRHIIRMTSANMDPAMMFRQRSLSQGSTNSNMLD
VQGGAHKKRARRSSLLNAKKLYEDAQMARKVKQYLSSLDIDTDEEKFQMMSLQWEPAYGT
LTKNLTEKRSAKSSEMSPVPLRSVGQTAKVHLHQPHRVSQVLQVPAVNLHPIRKKGQAKD
HVLSTSLPQKGLGPTEEVSVKKHTEDTISVASSLHSSPPASPQNSPRKGYTLTPSSKCDN
LSDSSHSEISSRSSIVSNGSVDSMSAAGQDERCSSHSLAVPEPTGALEKTDHPSGISDHS
QLAHGWMLSKPCLIKGVAVSSSLSSEEMSHEHVVLEAADSGRGSWTSCSSSSHDNFQSLQ
NQKSWDFLNSYRHMHLDDPIAEVEPTDCEPCACPKGCSRTCGQCKGSLETNQLRQSWASS
SSLSDTCEPNYGTVKRRVLESAPAEAPDGLEPRDTTDPVYKTVTSSTDKGLIVYCVTSPK
KGDRYREPPPTPPGYLGISLADLKEGPHPHLKPPDYSVAVQRSKMMLNSLSRLPPAPPSS
HTSAWVPSKIGSQPQRHSHPKLADVADADSEADENEQVSAV
Download sequence
Identical sequences Q5NCJ0
ENSMUSP00000099804 NP_780467.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]