SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000099936 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000099936
Domain Number 1 Region: 677-1074
Classification Level Classification E-value
Superfamily Ras GEF 8.5e-101
Family Ras GEF 0.0000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000099936   Gene: ENSMUSG00000039844   Transcript: ENSMUST00000102872
Sequence length 1086
Comment pep:known chromosome:GRCm38:2:29619770:29740978:1 gene:ENSMUSG00000039844 transcript:ENSMUST00000102872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGLGLRRSPEMSGKIEKADSQRSHLSSFTMKLMDKFHSPKIKRTPSKKGKPAEVSKIP
EKPVSKEARDRFLPEGYPIPLDLEQQAVEFMSTSAVASRSQRQKNLCWLEEKEKEVVSAL
RYFKTIVDKMAIDKKVLEMLPGSASKVLEAILPLVQTDPRIQHSSALSSCYSRVYQSLAN
LIRWSDQVMLEGVNSEDKEMVTTVKGVIKAVLDGVKELVRLTIEKQGRPSPTSPVKPSSP
ASKPDGQPELPLTDREMEILNKTTSVSPSAELLPDSTSEEVAPPKPPLPGIRVVDNSPPA
LPPKKRQSAPSPTRVAVVAPMSRATSGSSLPVGINRQDFDVECYTQRRLSGGSRSCGGES
PRLSPCSSTGKLSRSDEQLSSLDRDSGQCSRNTSCETLDHYDPDYEFLQQDLSNADQIPP
QAACNLSPLPESLGESGPPFLGHPFQLPLGSCLQQEGQQTDTPPALPEKKRRSAVSQTTD
SSGCRVSYERHPSQYDNISEGDLQNPVPVQPVPYPPFAAVLPFQQGASSASAEFVGDFSV
PELAGDTEKPPPLPEKKNKHMLAYMQLLEDYSEPQPSMFYQTPQSEHIYQQKNKMLMEVY
GFSESFCGSDSTQELAPPPALPPKQRQLEPPSGKDGHPRDPSVSSASGKDSRENGERSPK
SLDGLESAQSEEEVDELSLIDHNEIMARLTLKQEGDDGPDVRGGSGDILLVHATETDRKD
LVLYCEAFLTTYRTFISPEELIKKLQYRYEKFSPFADTFKKRVSKNTFFVLVRVVDELCL
VELTEEILKLLMELVFRLVCSGELSLARVLRKNILDKVDQKKLLRCAHSDQPLAARGVAA
RPGTLHDFHSHEIAEQLTLLDAELFYKIEIPEVLLWAKEQNEEKSPNLTQFTEHFNNMSY
WVRSIIMLQEKAQDRERLLLKFIKIMKHLRKLNNFNSYLAILSALDSAPIRRLEWQRQTS
EGLAEYCTLIDSSSSFRAYRAALSEVEPPCIPYLGLILQDLTFVHLGNPDYIDGKVNFSK
RWQQFNILDSMRCFQQAHYEIRRNDDIINFFNDFSDHLAEEALWELSLKIKPRNITRRKT
DREEKT
Download sequence
Identical sequences Q91ZZ2
ENSMUSP00000099936 NP_473391.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]