SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000099950 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000099950
Domain Number 1 Region: 482-821
Classification Level Classification E-value
Superfamily Folate-binding domain 4.24e-86
Family Aminomethyltransferase folate-binding domain 0.0000213
Further Details:      
 
Domain Number 2 Region: 68-289,389-474
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.34e-56
Family FAD-linked reductases, N-terminal domain 0.0000663
Further Details:      
 
Domain Number 3 Region: 289-388
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.06e-28
Family L-aminoacid/polyamine oxidase 0.0082
Further Details:      
 
Domain Number 4 Region: 823-917
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 7.03e-16
Family Aminomethyltransferase beta-barrel domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000099950   Gene: ENSMUSG00000009614   Transcript: ENSMUST00000102886
Sequence length 919
Comment pep:known chromosome:GRCm38:2:27188393:27247266:-1 gene:ENSMUSG00000009614 transcript:ENSMUST00000102886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLSRVLRVAATCPRGRAAWNLGLQPLATEARPTTEKSVPYQRTLKEEAQGASVVPQGP
SQPLPSTANVVVIGGGSLGCQTLYHLAKLGVGGAVLLERERLTSGTTWHTAGLLWQLRPS
DVEVELLAHTRQVVSRDLEEETGLHTGWIQNGGLFIASNQQRLNEYKRLMSLGKAYGIES
HVLSPAETKSLYPLMNVDDLYGTLYVPQDGTMDPAGTCTTLTRAAVARGAQVIENCAVTG
IRVRTDDFGVRRVAAVETEHGSIQTPCVVNCAGVWASKVGRMAGVKVPLVAMHHAYVVTE
RIEGIQNMPNVRDHDASVYLRLQGDALSVGGYEANPIFWEEVSDKFAFGLFDLDWDVFTQ
HIEGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGEAPELRGFFLGCGFNSAGMMLGGG
CGQELAHWIVHGRPEKDMYSYDIRRFHHSLTDHTRWIRERSHESYAKNYSVVFPHDEPLA
GRNMRRDPLHEELLGQGCVFQERQGWERPGWFNPQETAQVLDYDYYGAYGNQAHKDYTYS
RLLGDEYTFDFPPHHHMIQKECLACRGAAAVFNMSYFGKFYLLGVDARKAADWLFSADVN
RPPGSTVYTCMLNQRGGTESDLTVSRLAPGTQASPLVPAFEGDCYYLAVGGAVAQHNWSH
INTVLQDQEFRCQLMDSSEDLGMLSIQGPASRDILQDVLDADLSNEAFPFSTHQLVRAAG
HLVRAIRLSFVGELGWELHVPRASCLPVYRAVMAAGARHGLVNAGYRAIDSLSIEKGYRH
WHADLRPDDSPLEAGLAFTCKLKTSVPFLGREALEKQRATGLRRRLICLTVEEEVPMFGL
EAIWRNGQVVGHVRRADFGFTVNKTIAYGYIRDPSGGPVSLDFVKNGEYALERMGVTYAA
QVHLKSPFDPDNKRVKGIY
Download sequence
Identical sequences Q3TWI2 Q99LB7
ENSMUSP00000099950 ENSMUSP00000099950 NP_619606.1.92730 XP_006497851.1.92730 XP_006497852.1.92730 ENSMUSP00000099950 10090.ENSMUSP00000099950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]