SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000099982 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000099982
Domain Number 1 Region: 91-232
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.48e-27
Family Glutathione S-transferase (GST), C-terminal domain 0.0000537
Further Details:      
 
Domain Number 2 Region: 18-87
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.78e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000099982   Gene: ENSMUSG00000015093   Transcript: ENSMUST00000102918
Sequence length 235
Comment pep:known chromosome:GRCm38:2:25456849:25458776:1 gene:ENSMUSG00000015093 transcript:ENSMUST00000102918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAETTKLQLFASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRALDVLKDFAPGSQ
LPILLYDGDVKTDTLQIEEFLEETLGPPDFPSLAPRYRESNTAGNDIFHKFSAFIKNPVP
TQDNALYQQLLRALTRLDSYLRAPLDHELAQEPHLRESHRRFLDGDQFTLADCSLLPKLH
IVDTVCAHFRQLPIPAELSCVRRYLDSALQKKEFKYTCPHSAEILAAYQPAVHPR
Download sequence
Identical sequences A2AJ28
ENSMUSP00000099982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]